SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290184 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0290184
Domain Number - Region: 327-499
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00604
Family YbiU-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290184   Gene: FBgn0051016   Transcript: FBtr0300962
Sequence length 536
Comment pep:known chromosome:BDGP5:3R:26431911:26436178:1 gene:FBgn0051016 transcript:FBtr0300962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVVLFAVSFILVLSWIAEGYRDRQNYVISVEEKMDLLEKDRELIIVLDSYATELNEKI
IMLKRIVKEFKQPLEKAKNREEEYLSNPIDSLSLMRQMHEDWEKVEKLLKKPVGQEKIAL
VEKMREDLPVENDLMEANQAMFRILHTYDLEPKDVSAGWIDGVQYGGKMSASDCFTMGTF
SFMAGSYQIASKWLSAAKDLLVDQPRKYHEVMGITKADVTLLLARSLIASGNVSIATDML
MRDFMFGEAGSALTVHFLRNKPKPSINLESWESDESFNQLCRSSSRRQMGESKPSRLHCR
YNTITTPFLKLAPFRMEELSLDPYVIFYHNVLSDAEIEKLKPMGKPFLERAKVFRVEKGS
DEIDPSRSADGAWLPHQNIDPDDLEVLNRIGRRIEDMTGLNTRSGSKMQFLKYGFGGHFV
PHYDYFNSKTFSLETVGDRIATVLFYLNNVDHGGATVFPKLNLAVPTQKGSALFWHNIDR
KSYDYDTRTFHGACPLISGTKLVMTRWIYELDQMFLIPAVLPPRSRNFSKSLPNPF
Download sequence
Identical sequences Q9VA52
FBpp0290184 FBpp0290184 NP_001263119.1.81976 NP_733393.3.81976 FBpp0290184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]