SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290190 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290190
Domain Number 1 Region: 5-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.78e-66
Family BAR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 384-499
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.05e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00019
Further Details:      
 
Domain Number 3 Region: 258-360
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-26
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 649-766
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.46e-18
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290190   Gene: FBgn0039056   Transcript: FBtr0300968
Sequence length 767
Comment pep:known chromosome:BDGP5:3R:18944125:18949759:1 gene:FBgn0039056 transcript:FBtr0300968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRATIEFEECLKDSPRFRQFVSKEESDIEHLEQRLEKIIKLCNVAVDSGKEYVKNQSAFA
MSLWDLQQHFLDNKNAHNALGKLIHCFQEMNKFHTILLDQASRTVLKNLSVFVKDDINQV
KDYKGHFLKVSEGYDNALIKNAQASKNRPQEMQEAANILSASKSCFQHTALDYVNYITLA
QARKVPSILSTLLDYYQACVTYYHQGFDLCNDFDEFFKNISEDLNALRGDYQQLEKAMQN
RHMSVNRYCDSNTNSTSNKIEGYLFKKKSKGFKTWCRRWFYLSDNQLVYRKRSNEDSFSV
MEEDLRICSVRPVNEGDRRFCFEVISPTKSHILQADSADMLSLWISALQHSIGAAIQHDS
THHSRPQSTNAPNNSLPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECS
GVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEI
GVREAWIKAKYVERRFVCGMPKPQELLASETAEVLSIDSGGVVEDGESGGSGIAKRATLS
LGGTRKWAVKKLRRRQKQRSIPKTLSDDPSIYNTAKTGDELEDDDDDESINIPSMSLSIS
RDDLLVIGDDLALDRLETPGILGSDQESTDGESDAESPEELPFSQLDANQLLYMASVVHN
LPVMCMAFALGADKMWKNPQDRQRSFLHQAVISGSVMACEFLLLNGAAIDAVDEMGYSAL
HISTAKGHIAQVYLLLKHKAAYDLSSSDGKKALDIAVDQENADIVTL
Download sequence
Identical sequences Q8T0R1
FBpp0290190 FBpp0290190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]