SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290290 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290290
Domain Number 1 Region: 587-961
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.97e-99
Family Hect, E3 ligase catalytic domain 0.0000049
Further Details:      
 
Domain Number 2 Region: 229-328
Classification Level Classification E-value
Superfamily E set domains 0.0000000008
Family Filamin repeat (rod domain) 0.024
Further Details:      
 
Weak hits

Sequence:  FBpp0290290
Domain Number - Region: 37-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000471
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290290   Gene: FBgn0031384   Transcript: FBtr0301068
Sequence length 968
Comment pep:known chromosome:BDGP5:2L:2009859:2030536:1 gene:FBgn0031384 transcript:FBtr0301068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRSLKVLIAVVLSLMFTVSLVKIVLLIWSSHPAAPHSAPPLPTVDEWLESENLASYKH
LFRDKGISSLSSCGDPERLPELPPLDEQRLQRAALHLQQKLILREWLKDHRLQHHYQRLL
AVEVASLEDVYWLEDSRASKILGKDWQLWSGARQNLPTSKAQLDALKAQLWSTVVKSSQH
QDAWTWGGMLVVSVSVAGLVTLAAMTQPSLAPEARHSLLQYVTGKYLLPANCKVQWDWKD
PASVGGTMCFVVRFFQRNGQPYPICDTDHFFVEVTEGTRKVVTISELGSSTDPNNANIAK
VKFTVRTAGQYKISVLIGASHIAGSPFLRSFLPGAIDARRSRFIRPASTVICCAGAPTLM
HIEPRDEFGNSCLFDQNQSDEALQGYQVAIYDLHGVPVEKLQHAIVFAYDKVNSRVSVTA
LFPEPTCLRAVISYRDQQLPNGDFDIIVLSSSDTTLVHKNIASRKHNICYEAKLLSIFGV
SKNKPRKVLCYVGPKQNSLIFQVTIKEMILKFIPKRIATFRLCPSTKFHFLPQLVSQLHG
PVFIIDDGAQPKIELASKDRNIIAATFTHFLLKNIGGSETFKDKQDFFYHEVRKFHASYY
HEKMALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDWGGLRREWFELVCSAL
FDARGGLFCTFHDKHQALVHPNPTRPAHLKLKHFEFAGKMVGKCLFESALGGTYRQLVRA
RFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEEMYDSSSG
QLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLLSI
FDENELELLMCGTGEYSISDFKAHHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFT
TGCSQLPPGGFQELNPQFQITAAPTFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAISE
GSEGFGMV
Download sequence
Identical sequences A8DYT2
FBpp0290290 NP_001097053.2.81976 FBpp0290290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]