SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290307 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290307
Domain Number 1 Region: 8-278
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-58
Family Ankyrin repeat 0.0000546
Further Details:      
 
Domain Number 2 Region: 1161-1304
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-38
Family Phosphotyrosine-binding domain (PTB) 0.0017
Further Details:      
 
Domain Number 3 Region: 1006-1073
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000362
Family SAM (sterile alpha motif) domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290307   Gene: FBgn0039075   Transcript: FBtr0301085
Sequence length 1325
Comment pep:known chromosome:BDGP5:3R:19202933:19210499:-1 gene:FBgn0039075 transcript:FBtr0301085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDQEFLEAARNGNISHIEKVLTQKAKRAGPLASLRRGTGVNVQDSGGYSALHHACLNG
HEDIVRLLLAHEASPNLPDSRGSSPLHLAAWAGETEIVRLLLTHPYRPASANLQTIEQET
PLHCAAQHGHTGALALLLHHDADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAH
LGTEALERGTPSPSSPASPSRAIFPHTCLHLASRNGHKSVVEVLLSAGVSVNLLTPSGTA
LHEAALCGKENVVRTLLKAGINLNATDNEGRTALDILREFPPHVTKHIVAVINNFRNQMD
TDEGDEVIYRQHSGPPNSGRGQNKHHSQQQPPLSNHYHFNSNNHLLNHSHSMQQSGYSKQ
RLSAGNGGPYNGGKSLDSALQPEDRFYQDLNAHSPLHSQNEMGGGYSVSPSSSLSSFEPA
SVSPRSRCSTGGLGQPMHMSTFAPAGPPKKPPRRNLSVSPTHAGPGQQFSYSSPSSQSQS
QSHGHGQNQVRRQPASESPYSHQSHGSVGGMSFDETQLRERQRNDRLYASARQSTRSAIA
GGMSLSSSNDMLDRQCSSSELNSETSVPNSSGDSPATNSMKRPIPAPRSSTTKLSKELLK
SAESATLKSYNPNRKLKRNRNSSGANGAAKSNGGDENCEAKQQIPSSPTHYKQPPTPDHP
PPSSSQAERTIHERIRPLSQEYKRRSALLQLQAAQQLMIETGSSPSKLLPTLSTPGYDYD
DTVTVVPRCPAPSSGSLSSSISCSDHSLSHSTDYVEEFVSDVPFAGLLKGASQQLKEQPE
VKLKIQEESKPQQTLPRVRPPIPTKPAIPEKKFAKPPTTPTNQSLEANGNSSSDVVIKPP
RSPSKSPSKTSNKSPVKSPGKSPAKSPGSGHSAARNSINLLSPFNAEEARKKISEIIENF
GSGILNTSITPTHDIELDFEDMEVPNERRELATRLRAAGLLHLERILFENGYDNYKFVNN
VFEEPDIPLLHIPERDAPKLLRFVQSLPPAEFQPQVPVKTQQENKQMGVATLQQWLNTIA
LPEYLEFFNKHLYNTIESVCGVWDVELQTVLEINKLGHRRRILQSLAYIRQMRDSDSKSQ
KTPLGENNETNQLTTNGNGTAREAPPRLPANPVHHRNSITGYRKSRPAPPPPAPPARKTA
ALQIRAPSELLLGLPANLRTTEWRHSAQTLLNEHINYEVQYLGSTVVKELRGTESTKKSI
QKLKTSADGEVKSGSPLSLAICHRGVEFKDVNSKRTICEHEIQNINCACQDSEDLRHFAY
ITKEQDLHYCHVFLVESTDLASEIILTLGQAFEVAYQLALRDGITTTPELLLDNGMLQGE
YCGGK
Download sequence
Identical sequences Q9VCM6
NP_001287483.1.81976 NP_001287484.1.81976 NP_651143.2.81976 FBpp0290307 FBpp0290307 FBpp0290307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]