SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290392 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0290392
Domain Number - Region: 502-594
Classification Level Classification E-value
Superfamily Bromodomain 0.000458
Family Bromodomain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290392   Gene: FBgn0262598   Transcript: FBtr0301169
Sequence length 604
Comment pep:known chromosome:BDGP5:2L:8316889:8319908:-1 gene:FBgn0262598 transcript:FBtr0301169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIPIYQVPSVTMQSLHQQSLYQQTYLDRNRMVTDVFVQEHVSQSSWSMAGSSAVFIPGP
IITGSAHGHCHHTATVSTVSPQLATFMPFPGMQYYAASSATMNAYGHNQMYSTRASASVG
FYLPQYHASCSHEQPKKTFCAAQTQTQQTAKTSCDVGTQVDLDAEELRSEARKPRPESVV
PEESSISSLESGAGDGFRVQKKLRNSEVKLLDQRLHDITRVSLHGSEIAERLANAHRNRP
CFKKIDTLCARLKQDLLRPDGVLPNINSQGIAWAVKDFIFVFTRIVNAWVILKGYVYNTP
DALNKIKDELPSGFMASFDSWQISTLSIVKMIVKSFVNLDELLQKQKNSFSGKDGAPINQ
SNSISLRSFIDSNDSSGLAQKYLGMTTGHGPSAFSTPNNQIRNNAASKGQEPTSSALYKP
KCALNLNYLYTMIEDSEETQRHVDANGTYLKTGTYQPLQKESMQLEMPPAKPNDHYVERN
ANQQALPSQEIPNAPTPKSSPQSDRPRDVRSYTNPFSAIGKEVTRQLYEFSDRVMELKNL
ERFFKKQFTRNYYPNFYQHCQDDFIDVRAIILRCENSSYHHIYQAIHDLRRIIFTVRCYL
QVKE
Download sequence
Identical sequences Q8MSA8
FBpp0290392 NP_723373.2.81976 FBpp0290392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]