SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290511 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290511
Domain Number 1 Region: 23-99
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000196
Family GIY-YIG endonuclease 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0290511
Domain Number - Region: 195-258
Classification Level Classification E-value
Superfamily RING/U-box 0.0132
Family RING finger domain, C3HC4 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290511   Gene: FBgn0037263   Transcript: FBtr0301296
Sequence length 297
Comment pep:known chromosome:BDGP5:3R:467696:470358:1 gene:FBgn0037263 transcript:FBtr0301296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSYDPQDTASQQEESVALKGHFYGVYLLCSQSLDPRYRGKCYVGFTVNPKRRIRQHNLG
CDFGGARKTSRKGPWLMVMIVHGFPNNTVALQFEWAWQQPSLSTRLKMYPELKRKLPRET
FFDYNFRILSNMLGVGPWNRLPLTVRWLETDYERPFSKALPKHMEIVSGKVSISASQRRR
PDDAVPPPPVAWASECHLCMQEMEQPEKSRLGCTNQMCRLTCHMVCLANYLLGDEPGHYI
PVGGECPLCETRLSWAALLQRKRLLLGVPEELQDHDEDLSDDIDVDSDIEDTPELSD
Download sequence
Identical sequences Q9VN41
FBpp0290511 FBpp0290511 NP_649484.3.81976 FBpp0290511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]