SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290600 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290600
Domain Number 1 Region: 183-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Domain Number 2 Region: 249-332
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290600   Gene: FBgn0028734   Transcript: FBtr0301386
Sequence length 646
Comment pep:known chromosome:BDGP5:3R:5927298:5934033:-1 gene:FBgn0028734 transcript:FBtr0301386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYPFVNVRLPPEETVEVAAPIFEEGMEVEVFTRTNDRETCGWWVGIIKMRKAEIYAVAY
IGFETSYTEICELGRLRAKNSNPPITAKTFYQFTLPVPEELREEAQKDGIHKEFQRTIDA
GVCNYSRDLDALIVISKFEHTQKRASMLKDMHFRNLSQKVMLLKRTEEAARQLETTKLMS
RGNYVEEFRVRDDLMGLAIGSHGSNIQAARTVDGVTNIELEEKSCTFKISGETEESVQRA
RAMLEYAEEFFQVPRELVGKVIGKNGRIIQEIVDKSGVFRIKVSAIAGDDEQDQNIPREL
AHVPFVFIGTVESIANAKVLLEYHLSHLKEVEQLRQEKMEIDQQLRAIQESSMGSTQSFP
VTRRSERGYSSDIESVRSMRGGGGGQRGRVRGRGGGGPGGGNGLNQRYHNNRRDEDDYNS
RGDHQRDQQRGYNDRGGGDNTGSYRGGGGGAGGPGNNRRGGINRRPPRNDQQNGRDYQHH
NHTTEEVRETREMSSVERADSNSSYEGSSRRRRRQKNNNGPSNTNGAVANNNNKPQSAQQ
PQQQQPPAPGNKAALNAGDASKQNSGNANAAGGASKPKDASRNGDKQQAGTQQQQPSQVQ
QQQAAQQQQPKPRRNKNRSNNHTDQPSGQQQLAENVKKEGLVNGTS
Download sequence
Identical sequences B3LF78
FBpp0290600 NP_001163580.1.81976 FBpp0290600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]