SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290615 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290615
Domain Number 1 Region: 137-260
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.25e-35
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000101
Further Details:      
 
Weak hits

Sequence:  FBpp0290615
Domain Number - Region: 11-78
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000523
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290615   Gene: FBgn0264491   Transcript: FBtr0301401
Sequence length 405
Comment pep:known chromosome:BDGP5:3R:17867914:17905043:1 gene:FBgn0264491 transcript:FBtr0301401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVCESKAVVQQQLQQHLQQQAAAAVVAVAQQQQAQAQAQAQAQAQQQQQAPQVVVPMTP
QHLTPQQQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLDEEIARVRASLFQINGV
KKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRG
KGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQAEG
EDELKKRQLMELAIINGTYRDTTAKSVAVCDEEWRRLVAASDSRLLTSTGLPGLAAQIRA
PAAAPLGAPLILNPRMTVPTTAASILSAQAAPTAAFDQTGHGMIFAPYDYANYAALAGNP
LLTEYADHSVGAIKQQRRLATNREHPYQRATVGVPAKPAGFIEIQ
Download sequence
Identical sequences B3DNL7 O01367
NP_001163683.1.81976 NP_524447.2.81976 FBpp0083575 FBpp0290615 7227.FBpp0083575 FBpp0083575 FBpp0290615 FBpp0083575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]