SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290651 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290651
Domain Number 1 Region: 171-465
Classification Level Classification E-value
Superfamily L domain-like 6.8e-47
Family Internalin LRR domain 0.058
Further Details:      
 
Domain Number 2 Region: 98-205
Classification Level Classification E-value
Superfamily L domain-like 0.000000136
Family Ngr ectodomain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290651   Gene: FBgn0260793   Transcript: FBtr0301436
Sequence length 1141
Comment pep:known chromosome:BDGP5:3R:8947673:8981386:-1 gene:FBgn0260793 transcript:FBtr0301436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKIVNQHCDLGLALLLAWTWLTRLVVAAHLVDIPTSSRLAAEREEQQLSRQDVGRLSYQ
SIHRMLRDENEPDSFRGELRYQQKRHKRELELNAPANKLNLTHRDLRTFNSTGGQWKGDF
QVITAMDLSSNQLESLSLDNFNQLRQLDLGNNSLEVIPLSLADTNMSLPFVTLDLSCNKF
SQISTSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETFLAL
PNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASGTG
LCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRLELL
ESLFLDRNLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIFLPP
LSLPKLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRSVDA
GQSNGASVSGRVDLKTEYLQFHNFYENFSSRECGIRKPENDTKPPSCSLTRASATLTTTP
RSMSKVEKSQEAQATATSVEVAAATAATSEKTGIQATSAAQSTAAATTAEREAIATATSS
DTTATPTLAAAAAIQSAGNIPAQLTTKTLRPTETTSLAQLQRRQQMPGMPAKTTETPAKN
LPSLAQTKATTALPILATRDAATATTEINSDKPTNISGATKTVATSAAEIATPPAIEVPQ
TILAGKKSDKMPADKAHETLLKYPTRDTSGQVATTPHKHATLQLHVKDRHLIGTPLLMHK
GDVLLVDAEQLLLPGTATVADADSEVLDPSQQHQSAEQEKHQSATDKRQADAINGDTKSP
AKGHKKKPSLSIKKMTYSTKHAAKTVEDMAATSKTPQHQHSSVNTPKEAAPEELSTFAQL
KAYVELKSESKPEHLMDQREENHHNLTGNHPGVMLLVACVLFIVLLAGLAHVYRCELPWQ
RSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNSNGGDPARLQKWHHSTRREAPYSSPLH
NLQARELQQQRCQQFYSSSLADKSSSTSSSSSGSSRSSLHSPSRDDSYYIEMAPSSPPAA
NLPSLPMELLGSRSNALGCRTDRVAATDLGGTTEAVPSSAAAIKSVSSRLMTPSSRRLNI
W
Download sequence
Identical sequences Q9VFY9
FBpp0290651 FBpp0290651 FBpp0290651 NP_001287310.1.81976 NP_001287311.1.81976 NP_650258.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]