SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290722 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0290722
Domain Number - Region: 123-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0628
Family FCH domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290722   Gene: FBgn0033988   Transcript: FBtr0301507
Sequence length 477
Comment pep:known chromosome:BDGP5:2R:10868782:10878841:1 gene:FBgn0033988 transcript:FBtr0301507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAEDGELDPQIQIELENLNSATDEINKLEIELEEANSTFRILLNESTRRLKVSSKKLG
NCIEKARPYYEALDKAREAQIECQKAAVKFQRANEIHAAAKETVALAEQRFMSNSHEWQF
DNAWQEMLNHATQKVMDAETQKADCHAEHQRLTKLFNAAEQKLQQLEDRFRRSINKSRPY
FEEKQVCQDQLQTQKNRIQELQQQVAGAKSTYSTALRNLERISEDIHRQRGDFPTPPGPR
EPGVGAELNSPTSSALPSLPDFQLELEKCDYPSIAGSQMSLGAKTPQAAAETEDEEDACD
YDETGAGELRGVVDERDLEALRQKVKILAVRPIEGGDGQQQNDVWEHELKATVDKLDHLM
MLKETAKRQQTNRLKSTEQRPDSLGAEALKRHCDVVEVKVTSCATTASLPVTPHHQLNHL
APPTPIKKLQQQLAPLPSVNVSMRELPLLARLSNELLDRSSAAFGGVRKTLRRRSLE
Download sequence
Identical sequences Q9V785
FBpp0290722 FBpp0290722 NP_611010.4.81976 FBpp0290722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]