SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290817 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290817
Domain Number 1 Region: 661-857
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-64
Family Sec7 domain 0.00000533
Further Details:      
 
Domain Number 2 Region: 858-992
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290817   Gene: FBgn0026179   Transcript: FBtr0301602
Sequence length 1220
Comment pep:known chromosome:BDGP5:3L:21041326:21068544:1 gene:FBgn0026179 transcript:FBtr0301602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYTAAQYYKTTNMITSNEIYCFPQKSLERSGSTQYELAGAQQPGSANASTCTDSGSVG
GYVYLQNHYAPGAHSSSAAINYPAQQHPQMVYQIQQYPTCHQQQQQQHLQQQQHLHQTGA
GHYMQVTATGGGQYHHHHMLHGHGHHAHHHGGAVVIAGSGVGTGLGSGATSVIMQHQQQQ
QQQQNMHKKNSIRNGGDVLKRTRAQSAYELSQDLLEKQIELLERKYGGVRARNAAVTIQR
AFRHYMMVKKFASITAMAKAEKRLSRRMVVTASSLGLAEEGASSSSAYGSATESQLTEQQ
QQQQAQQQQQPRVTIMAGPAGAASPGLSRTPPTRSLSMRERRQLDCSPIPRSQSGASPAS
ISSSTVSTSALASHPHVNLLHAAEPHYYNAQALPQGAAYYTSYHGSPHDLSYASSADTSL
NASWVNTSGHSPHTPYYSAAQIYMRPKGGSTTPTPSCSGSTGSGSGGSGSGSSKKVPPEV
PKRTSSITAQQQTQLLLLQRQTPPPPSLLRTNGLCKTAENGSLTSVQSSGSDSSVTSAER
NLNSDLGSDRSNSPHTWKRGTALNSSQQFSTHSADSAGAVSGGGVGVAGGAGVYAAQMQA
AVAAATAAGGMPPADDHAISSHTSAAQYEQHEQQQHEQQQLQAAAAAAGVAQNYKMSETI
RKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQN
QFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIV
GRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGI
YDRVKSDEFKPGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRLYEIPDVNKKERPGV
HQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDG
KILITFNARNEHDRCKFAEDLKESISEMDEMESLRIEAELERQKSARNRAPGNAENRDSG
VADVEVCPCPYQQGSQASGEQAPNSADNSQQLKRSALSNSLLDMHEQFGNEKPQRRGSVG
SLDSGMSISFQSTTTSSASRENAAAIAAAANAAAAAKMRFNMPPTAAIATPSNVYAAPGM
QAYTHANFVQQSQAAYMLQQQQMLQQQAQMQAQAQAQAQAQAQAQAQAQAQAQAQPLTGR
IPGRERKASRTDENGRSTEV
Download sequence
Identical sequences E1JI59
FBpp0290817 NP_001163487.1.81976 FBpp0290817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]