SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290846 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290846
Domain Number 1 Region: 61-202
Classification Level Classification E-value
Superfamily TRAF domain-like 3.27e-46
Family MATH domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 209-326
Classification Level Classification E-value
Superfamily POZ domain 2.44e-33
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290846   Gene: FBgn0264493   Transcript: FBtr0301632
Sequence length 406
Comment pep:known chromosome:BDGP5:3R:9793674:9797520:-1 gene:FBgn0264493 transcript:FBtr0301632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLIQEPRLPVNECQASQTARVTSNLHASSSTMAVSRVPSPPLPEVNTPVAENWCYTQVK
VVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYL
LLVSCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANG
LLPEDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGG
REFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEK
MADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTH
ATDVMETSGWQNMITTHSHLIAEAFRALATQQIPPIGPPRKRVKMS
Download sequence
Identical sequences A0A0P8YGX7 A0A1W4USH7 B3P0K1 B4G4S2 B4HF69 B4PTD9 B4R0J2 C7LAF6 I5ANU6
FBpp0290846 FBpp0187426 NP_731875.2.81976 NP_731876.2.81976 XP_001979869.1.56816 XP_002013602.1.64850 XP_002031257.1.34323 XP_002097926.1.41174 XP_002103504.1.80810 XP_003736558.1.19638 XP_014767099.1.52611 XP_016960063.1.21709 XP_016983897.1.97277 XP_017001258.1.47939 XP_017026616.1.37106 XP_017046928.1.74164 XP_017084414.1.81094 XP_017091706.1.53830 XP_017140916.1.22881 XP_020817872.1.32911 FBpp0207371 FBpp0255080 FBpp0291895 FBpp0290846 7245.FBpp0255080 FBpp0218866 FBpp0140134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]