SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290847 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290847
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily TRAF domain-like 2.78e-46
Family MATH domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 177-294
Classification Level Classification E-value
Superfamily POZ domain 2.09e-33
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290847   Gene: FBgn0264493   Transcript: FBtr0301633
Sequence length 374
Comment pep:known chromosome:BDGP5:3R:9793674:9857777:-1 gene:FBgn0264493 transcript:FBtr0301633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSRVPSPPLPEVNTPVAENWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSAG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCNKSEVRAKFKFSILNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPEDKLTIFCEVSVVADSVNISGQSNIVQFK
VPECKLSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNR
VAITDVDHEVLKEMLRFIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVE
TAAETLILADLHSADQLKAQTIDFINTHATDVMETSGWQNMITTHSHLIAEAFRALATQQ
IPPIGPPRKRVKMS
Download sequence
Identical sequences A0A0P8Y1H1 A0A0R1E3Q2 A0A1W4US38 I5ANU5
FBpp0291894 FBpp0290847 FBpp0290847 NP_731877.1.81976 XP_003736557.1.19638 XP_014767100.1.52611 XP_015010213.1.56816 XP_015048300.1.41174 XP_016034765.1.80810 XP_017001260.1.47939 XP_017026618.1.37106 XP_017046930.1.74164 XP_017084416.1.81094 XP_017091708.1.53830 XP_017091709.1.53830 XP_017117295.1.32376 XP_020817873.1.32911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]