SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290872 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0290872
Domain Number - Region: 715-783
Classification Level Classification E-value
Superfamily RING/U-box 0.0271
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290872   Gene: FBgn0026160   Transcript: FBtr0301658
Sequence length 1109
Comment pep:known chromosome:BDGP5:3L:10851504:10869596:1 gene:FBgn0026160 transcript:FBtr0301658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQQAGSSRAPATGGQISPPGATTVGVEQQQHLQQQHQQQYYNQQQQQQQQQYQQQHQRD
NFLAYQQQQQQQQQQQQQLQRSGGGGGNFMLGNDLVGGDSLRSLNNTFGPNSEFTSLGGA
NSSASSSLSGLSSSSSQGYTGMVAASQQHQQQQPHHHQQQQQQQQQQHMGSMDAMGGYSQ
MGGGMHPGPNSGMMGNMNGQYMNGGSGQGGYNGAQGMGMGYGGGGSMGPQRHHQMTPMNQ
MQNMSMGPGVGGSGGMGGGMNPLQQQAAQQQMGGMNPMAKMQGMANGGYPQQAPPSLTQQ
QQQQQQRRMAPYPHPQMHMAQKRAAAGVGGAGGMYPGNPMQQQQAQMYGNQQMHPGSGGG
VPLPMQAGGAGNGYGRSGPMGVGNGGYGRMSAGNGMGPTGGPVMGPMGPGGMTAGGMGPG
PGCMSQQRFMPQGSGGGMPGVGYGGVGGAASHQGQFYPGSGQSAGMQQAGGMCPAGPGAV
ATTGNPYQNQGFQQNYQHSPVPGNPTPPLTPACSVPYVSPNPDIKPPMDNSEEMRLTFPV
RDGIILAPFRLLHNLSVSNHVFHLKQNVYNTLMCRNDLELQLKCFHQDDRQMNTNWPHTV
TVSANATPLNIERSEKNSTALRPLYLKAVCQPGRNTLQLTASSCCCSHLFVLQLVHRPSV
RQVLQTLHKRNLLPLEHSVQKIKRNLSQPEANAGPDATPQQQQQQGGGQQCAKISLKCPI
TKSRIRLPARGHECKHVQCFDLEAYLMINSERGSWRCPECSKSAITDTLEIDQYIWAILN
TLGNSDVDEVIIDSSANWRALQHNGGMPNAPPPSNVPSNPSGGSGSNSGNGSVNPTLPVI
KQELCDDIAKVMSPGSTQLPTWDSAQAMSPYNMHDMNSIASGNMMGNGGNTNQHGNRSSY
DGFSGNHSDGSGGLPGGDGGVNSLDQLNAMEKSLSDQMPHTPHTPGAASHPMTPGGPPSV
SSSHNEPISGGTPNANGSGSATNGSGNNNSSTGHNSPQTPGTPSRMGGGMGGSGSADSQQ
QQQEQLLNSLMSSQTQLKFSESDLSAELQSFDAAAAAINDTAHDLNLLQDVDPMEILSYL
DPQPDLNTPPSSGSSNNNASDDLLATLFD
Download sequence
Identical sequences Q7JR52
FBpp0290872 NP_001163413.1.81976 FBpp0290872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]