SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290897 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290897
Domain Number 1 Region: 158-345
Classification Level Classification E-value
Superfamily TRAF domain-like 3.92e-48
Family SIAH, seven in absentia homolog 0.00000216
Further Details:      
 
Domain Number 2 Region: 103-146
Classification Level Classification E-value
Superfamily RING/U-box 0.0000292
Family RING finger domain, C3HC4 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290897   Gene: FBgn0259794   Transcript: FBtr0301683
Sequence length 351
Comment pep:known chromosome:BDGP5:3L:16852180:16853629:1 gene:FBgn0259794 transcript:FBtr0301683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRNSRPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPD
AAAAGELVPSRRKDSVAVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQC
PRGHLICSTCRSKLTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKT
KHEEDCECRPYFCPYPDDKCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGA
LDWTMVQSCHGRHFLLSLEKINLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLR
WQSKPRSIRENFSSFTNADFLVLNKHTVELFSEDGNLALNVVIRKVEERTN
Download sequence
Identical sequences B5RJD9 Q8T3Y0
FBpp0290897 FBpp0290897 FBpp0290897 NP_648927.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]