SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290962 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290962
Domain Number 1 Region: 1599-1650
Classification Level Classification E-value
Superfamily RING/U-box 0.00000414
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290962   Gene: FBgn0260970   Transcript: FBtr0301748
Sequence length 2219
Comment pep:known chromosome:BDGP5:X:7829929:7847916:1 gene:FBgn0260970 transcript:FBtr0301748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDDNLSNADISIDDEEVVREQTHHPPMQEDQELDNEDGSSDVDLSSVYVVPPIVSAPS
PASVRIAGGSTIGGGGVAAGAVPTTTDNSHSPFHDWDSSVAAAAAPPPPPPRTGPTTTTS
SGTAAESGAASALSDDAGAKPSFFFGASSFSLRSRKEVAALINTECCRGSPTPDLDSIMD
TLFNPGTPIDNLDNIEWIRWLIAGGRTPQEFVKIVRSYDNHAKCGLVWVPHVVAYRCRTC
GISPCMSICRDCFKKGNHTNHDFNMFLSQAGGACDCGDTSVMKAEGFCSDHGINNRVNRD
PVPNNLLAVAEAIMPKLLFRLLQHFREHSDTPLEVQAITSYSCEEFANMLIDLNNMGEIM
RKVMTRTLINPEVYAFFMEAPCQDTRNGRFLKANREKYEDAVNRFPNPEPPDEYRDLPAL
GDKLVHTTLLEEFIFWTFKFEFPQTLVCFLLNMLPDQDYKEHLTRTFVMHYSRIPSVLEM
SRDPDTLSNRVVHMSVQLFSNESLALKMVNELSLLHVMIISLKLMMSKILIQNTLHDPNK
NFHFVIDCTRQVMKDHCYWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFLQMLQGMNV
NVRETASHVEFEPNSYYAAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTTLHE
WLDSIYFMEARLSMEEMMQASFHFPLHRYLAAFVCQAVTKMGISLNDVLPSRPYLLPLLM
IHPLRVQSFFYEILAGKWVRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYF
FLQNTIELFDVGQWLETAPLKQPQKAEQSSMLEGFLTFLATLVTSRTNLGNDEATQCIIE
ISALLATENKTHSQLLELMPERSGNVHTKNFETFLKKLSVYKAPSSGSENLEQGLFTPID
EVWEKHYDPLHVLLRAVHRRDFQSSLDRFTNYVKSKDKMPASGNLWPPFRLPHALPATSS
FSDPCKILNSRIFHSTILSIFFRAVHTRDVSEHLLALAVFLLEIAVETSDDVGSGTGDRA
PPALAAVVESSSGPGYHGYGTGRHEPPKLFHCYPTDNLSCNLRHVVKKVSLKSRDPQVIT
SSYRSNPFYSDLDFEVEADPEQSMRMIGQGDPEGDEATGGAGLGMGAHSRRNVSQALVPM
RVPGMEVALPPDLSVVAETGVVIRQDSNEDDLLREGNHAMDMSPPAALDFHFPLQQITLP
ESGMEVAIRRDLLLAETNNMGAIAGGAGGGANASATPPAGASNEMFSPTTPTGSGMLLPF
QRVQPVAVPSSGNMDIVPSNAMGAGGSFTSGVSGSGTGRRMNYETGGARKRSVDIAIGGS
NKDELHLDESILSLLLKLHSQLSGTLDSFSLSDGEDQSSDDDSTMDVDCNEASTSMAAAE
STALAERGRSKRNYKNIHVSSSRIGDGPFFIGNLLRKIAKQDEQCAQSIDDIRARLWPNQ
REKQAEAKAREAKEKEERRKKARERQQKMMQDFANKQKLFMQSAAASSSGMGYGPEDEDD
EELYEEQPREKEYDCIICNCTTPSTESNPIGLVVLVESSGIVGHRRRIAERLPLPINAED
ESRLAHTTRLAAEFNRRTELLSLKFGDESWYLSNNMAYDNGVHVQSCGHHVHLSCLEAYL
KTLYTTQRQPVQDRGEFYCPVCRQLSNSVLPLSPQLDRPTHLVRSGNQPFERLVADLTDL
IKENETIPQPTKLTEAMGHAMEVMTNIAQRKVKCSSITFRKLFIFVTSIARTNLEAEIIQ
RGGSLCTANATRYKPKRECIVPLLHVLSVHVRVLVEWPLWSSWASLAGLPVTATEPLPAH
CLELIPSILADPIALLLKFILLAPLQLDQDYFTCMVKVMYNLLYYQIVVQLCVTLTDLEC
DHIVKVYGSTSVGSDNSAAESQQQESAAGTTNNRRRAGQQQQSSSQLGKAMALVLSQTND
LVHLRRDCIPSTSSSAAASAAGSSSTTSTNHGASAATASSATTIEVNLKSMELQLQALCL
PFLRVAALLRQHLYRHEMPEISAPGLEFVRLVYYLELVTDSMDWDCFNASKGLCFIPGTE
TTLPQFWCQQLMEVRPPADTVRELVLINQHSLWQQPRLLELPREYERLFTYYHERPCLNC
YKVPKESSICLLCGTIVCLKQNCCAENDCCEAVRHTLSCGGGIGIFLVVTSTYIIVIRGR
RACLWGSLYLDDFDEEDRDLKRGKPLYLSKDRFNLLESQWLSHKFAHTKHTWVFHRDLL
Download sequence
Identical sequences Q9W3M3
FBpp0290962 NP_572428.3.81976 FBpp0290962 FBpp0290962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]