SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291094 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0291094
Domain Number - Region: 200-549
Classification Level Classification E-value
Superfamily TPR-like 0.000417
Family HAT/Suf repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291094   Gene: FBgn0014024   Transcript: FBtr0301880
Sequence length 555
Comment pep:known chromosome:BDGP5:X:5212961:5216743:-1 gene:FBgn0014024 transcript:FBtr0301880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADKQLERQLEKELDEMPAEDLDDDAYDEYDLIVIPDQGKGSPQQGHSESPQQEEEHKS
EELRQRSRPTWPPSSAGGDMTTIELISSDDEPSVEETEGGNAAGRGRARNDSSSSSDDVG
VIEGSELESNSEVSSDSDSDSDNAGGGNQLERSYQELNALPSKKFAQMVSLIGIAFKLND
LEKIESSVLELQNLATVPAHVWLKYLKARLVVTQTDEERKAFEEQCAKALGYYYSIPLSE
YVVNYLVDQGNVQNHVLWAKLLADYDVERPDFGDKLRSLISTITDENEAAAFVEMLQKHC
VTWTCNVEQRQMIKSVVDKFKQHLDETTRGWDWSEQHKAHVYDVETLSLDDDLKNAVIRF
IFERSVAKFPIVDVLWLSYIEFIQFEGVTVPENEDENEVTAEMVAKRAKRLGKGFLRNTE
LDLANRGVRSHPSVQLNHRFLDLMERSDFELAEVDEEIRLILQRIVTDMDMTVELHLDYL
AYRIRNTNASDEQQVASLRAAFNHAWEELTVLYGDQADTRYEVLQLWAQVEYTQLGSPDN
GREIWRQIMGERFEI
Download sequence
Identical sequences FBpp0291094 FBpp0291094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]