SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291132 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291132
Domain Number 1 Region: 423-714
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-53
Family Rhodopsin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 1-301
Classification Level Classification E-value
Superfamily L domain-like 2.72e-49
Family Internalin LRR domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291132   Gene: FBgn0003255   Transcript: FBtr0301918
Sequence length 943
Comment pep:known chromosome:BDGP5:2L:13982726:13990719:-1 gene:FBgn0003255 transcript:FBtr0301918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSLPEGLSKLSQLQELSITSNR
LRWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLRSFPELEACHAL
EILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSSCRDLRLLDLSSNQIEKIQ
GKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGFTALED
LNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTFPRIQTLILSYAYHCCAFLPLV
AMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQLGASMHDPWETAINF
NEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFSGMSTEDFQPGSVQCLPMP
GPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSRSKMDVPRFLVCNLAAADFF
MGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELSVYTLAVITLERNYA
ITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKFAVCLPFETTTGPASLT
YVISLMFINGCAFLTLMGCYLKMYWAIRGSQAWNTNDSRIAKRMALLVFTDFLCWSPIAF
FSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDCVTLCKHFEESRVV
GGGGPGGRGAVARTKRGDLPPPLLPAAAVAHPPGCRCLRMLPSEMPNWHKMEQTPSMWQR
LRTFCCGENRRRRKQRRQPQQRRQRAYTAAAANPYQYQFAELRQQRQNRASSISSENFCS
SRSSSWRHGPPSSAPVPPGNCSMPLKMLEPHAHPHGHGRRRHSAWLITRKTSQDSNLSSS
RNDSSASATTASTSTFRLSRSSAGSSTPLPSIIGKWQTQNINI
Download sequence
Identical sequences FBpp0291132 FBpp0291132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]