SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291182 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291182
Domain Number 1 Region: 90-131
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000054
Family B-box zinc-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291182   Gene: FBgn0031857   Transcript: FBtr0301972
Sequence length 180
Comment pep:known chromosome:BDGP5:2L:6769837:6770949:-1 gene:FBgn0031857 transcript:FBtr0301972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTHQLLNKNVRTMPSWVMEANDRIGPKPPPTPPNGVAGGLPKAPALPPKAKSTPEPDYE
IIEFSSQQYSNEPMKTTVIRTKTPDNKLKCTLCGSQNPWVTCAECAGQIFCASCDDMFHK
HPKRKQHMRKAVEQGTPPIPPKAQAGGGAPPPVAPPRRSKRGLLTPFLGRKDQVRHCTIS
Download sequence
Identical sequences E1JHA3
FBpp0291182 FBpp0303664 NP_001162896.1.81976 NP_001260161.1.81976 FBpp0291182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]