SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291244 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291244
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-72
Family IMD domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291244   Gene: FBgn0053558   Transcript: FBtr0302034
Sequence length 2027
Comment pep:known chromosome:BDGP5:2R:2813207:2859142:-1 gene:FBgn0053558 transcript:FBtr0302034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSLERDSSALGSLFQQIINDMKNTSPLWEDFVAKAGKLHTCLRAAIQAIAAYLDAFQK
IADAATNSRGASKEIGTALTRVCLRHKAVETRLKTFTSTIMDCLVQPLQERIEDWKRTVA
TIDKDHAKEYKRCRSELKKRSSDTLRLQKKARKGQTDGLQSLMDSHMQDVTLRRAELEEV
EKKSLRAAMVEERLRYCSFVHMLQPVVHEECEVMSELGHLQEAMQSIALVTKEPSVLPQA
SEELIHDAKASINLYPESPGGGSGSQGGGCSNSLGSRKSSVCSISSMNSSGSSNSPGHHH
YPRSLSQTSNATNQTANVSTWPPHSQDGVDTLPPTADRPHTISTAYEKGHQRPPLTVYTF
QNPETIHESGSCLNNGTAAPNGQPLSGQATPATQKSPAASLSRPPLPVRCSSLERPLSAQ
SNHRQGSGNNLLQRQCPSPIPAHITKELSAAHHAQQQQQQQNQQPQTPPTYVNMSELATM
AALKQTNQQQKPSTPPLQQQSSIDSTSSQHSNDSTGSHQLLQQQQQHHQSQQNHHSATAT
RSHSISSTASSLHSHPSIDSTVACGSLVGQHNHSTSTNTNTTSPSSGSSTPQNHYSPLLT
NSPTSTAAGTPSGSSLGPGSGLGFVYQVSSPTPPSSEVLKITEQAAAGQDQGPANSVADE
TDERSRASVLQKASMFEKAAAAAAVSPPAPMQIASGSPASGGGTRRSEAEQQEMDKSFED
SIQALNNLIGELDSFQREIDEGKVKPPSNIISGSTTSSNNNNTTTSSISSSDNNNLPATS
NIEPCAISNQTNSSGCGTDISDTTSDELAGDDMDVRRRDRDRDRDLLGASDSELSRCYVS
ETSSLTGGLTAGGYENPTFAHFAANANREDAVSLASDSVCLGQPRHAYVDTCSDSGSAVV
VIYDHQIPNTPDIEFVKQNSEIVVLRTKDPQPHALQLHEMRELQQLPANLAGSPDSSPDS
AGGQAPPTATVAPAKQRLSSFRATSEQQLQLLGRGSPQRGKTPSEQAVQSRPQDQHFPQT
QQQDIDGSSPPVELARRQLPPKPTSLSIFNGPVPTAGDRPVVPRKSDFKADLDAKIRRQK
QKVKQQLQQQQQQQQQEQQETQQQQQAPQEQQHSPQSPQTRNCNVTNQQAANITASASAF
ATATASTDPYPNPNHRMPNQNQTATSNHTQCKTPTMALSPSSPRGHLPLSSSSLSSLPLP
ATTSSPSNARPSMLPASDRPPAHPYVCSNAPANPHHANSISNANAHLKPCITPRPASLSG
GAAGGGSTRIGRRSSINQSKPPPPVRRSSSVTPSPNASVGLQQQPQHATLSQQNHQLSSS
SEHLPPPPPFMLDAMPQIPSSALKVSETVRALAAMRHQPASPVSLRRMQQQQQQQLQQQQ
QQQVQQQQPLLQSAHNSPLKEDLTVYYDSYLDLHAYAQALASGQQPGGQQMANQQRFTLQ
QQHQHLHQPQQPPVYQVDATFRTSSPAAGGGGGGGIYAQPKLVNSMSSFRTSSPSPNGHA
HPLPPTQPKANPNLIAQLNARLSGKQQQHQQQQHIEGIYGNQQAPGGESIYMRSGLSMSQ
PQQQQHFDGKSEQIQLQHQQQHRIYASFGTSSSAMSSAHAANSSTKPSILTPTTSFNALP
HFPLSSSTSSLLSKVSSFSNSSSASPPTTAATSGSASSHYQPPQPPNAAVANSKDMAIYS
SSFTKNPAAAQSPNMRQAHSHQHHQPPQQQHYTCPPPLEDPPPPPIYAAGASATMPKKMA
RPPTGQNATHSSAYAAASSTATLPKNMMQQQQRLQHQQQYQQPAGMGIGNGNGHLGQRPQ
LPLPQQKLRAAQQQHLAEQQHQQQQEQQQHHQQHQQHQQRQPPIPSRHSSVQQKIFVSTN
PFIQTTAVKFHSPSASPTCGSPVTGSLASIYATTSRGGHHHQQQQAQQQQHYYRDAAGGN
SNGGAAYYNHNAHAHSQAHHPNYATSTNIEKTGSIRAKTKAEFLENLNAKLAKQGMSGRA
FAVRNLINSKALPDPRICHESLMDQIKRGATLKRNQKINDRSAPKIH
Download sequence
Identical sequences A1Z6S0
FBpp0291244 FBpp0291244 NP_001014500.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]