SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291246 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291246
Domain Number 1 Region: 190-318
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.23e-24
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 2 Region: 1271-1453
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.59e-23
Family NAD kinase-like 0.073
Further Details:      
 
Domain Number 3 Region: 1667-1730
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.43e-18
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 
Domain Number 4 Region: 90-160
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.17e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000654
Further Details:      
 
Domain Number 5 Region: 23-86
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000643
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291246   Gene: FBgn0085413   Transcript: FBtr0302036
Sequence length 1733
Comment pep:known chromosome:BDGP5:3R:3647757:3679622:1 gene:FBgn0085413 transcript:FBtr0302036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDWLGSLKTATAPQRPRGDSFLIEQHDILSNHHHWYATSHARPTYCNVCRDALSGVTSH
GLSCEVCKCKVHKRCAAKSIANCKWTTLASVGKDIIEQADGIIMPHQWMEGNLPVSSMCA
VCKKTCGSVLRLQDWRCLWCRATVHVACRPQMAVACPIGPAKLSVVPPTSVHSISTDDAW
DVASPKGNFSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLISTGPSLGLRLFRHFE
MFRILVCSGDGSVGWVLSEIDRFNMHKQCQVAVMPLGTGNDLARVLGWGSSCDDDTHLPQ
ILERYESASTKMLDRWSIMVFEKAIPVPKTPKMSISTEQEAMLTGMVTSANHHLRFIVET
NDTQTLIRSTRNLCDTVDDLVCRISEHHKDDEQLAVKCDILRQKLNMLLDALQEEEIGAH
SGDDLIATIRSLIARSIPVTPGSNAYLLNPNISIEKTEKDQINTKERRNSRSLRSSEKEA
LQCRANSVKRAIYNVVEHSEPGRPKRYQRKLSITPFEALKLPTASGESTPCTSPLPIIPP
INIISPTMETSRLTCISPLPDTRRDSVDENFFNSINLPAPRQFADSRRSSGVEVIQEIEE
GANGETVYRKSRMSLTGGANIDDAGNRLSPCSDAGENTPTERKVDFLRVPIHTGEPIVDP
LCDYRPHEVFERTYYMTREMDKGKEKDKEKDKPVEIDKEKDTCVEKEGSMPAEKLVHTCN
LQVPGVVVTPNPQNVYSSASITIIDTDAQTTTEQSSSDDLGGEASDVLSAISNEECSVAS
EIFDKQDAGQTVGDIIQNMDASNFTHIDSPETSDETEAMPGESIMDDISSVLGHDITYAL
QDNTLTDDTTTLCSEHAGPPKPPRKKSLSALSRTQAHPRRRNSSPPRMARLARMDSDDNP
QQFGFENIVFEIDNRCDDQKMREPPRYCSLAQFVEGNDIARQSFKQLMLEQHRGGDNDSD
YPEHEQTPTNKGANLLATTSEDELSTQTAIKIEIQDIDATVRNLNSSMKPNTILTTSTSP
TKKSGHGQDVKRITFDESCKKESFDDVNPNYPQISVVVRPPTPLRGDCIKPTVSLLPVSS
GGAMTVSMTCSGMLGVRAMNASEIRRHSSHAPGLAVREFDKDKDRRHSGFNPNQLTLDPE
HARFLSSSPAASRRISCGSLFKPNEALPNLQTLKGSKSSLFMGSTLFGFDHLASAEKDKE
EKSGKDKEKTPTDETNRKLPIINPLVRLPNWPNLANGGGFISKCLLANADTLCAAVSPLM
DPDETLLAGYHEKCVMNNYFGIGIDAKISLDFHNKREEHPEKCRSRARNYMWYGVLGSKQ
LLQKTCKNLEQRVQLECDGQRIPLPELQGIVILNIPSFMGGTNFWGSSKKDDIFLPPSFD
DRVLEVVAVFGSVQMAASRLINLQHHRIAQCQSVQINILGDEEIPIQVDGEAWLQPPGMI
RILHKNRVQMLCRNRSLELSLKSWQEKQRQHSISIQRDASSTASEHANSTDEVISERECY
VLLNFIEAVSSLVKWVKFLIISHPALQHDLYEVACRASEALESIHPQGKLLEGPSLRTKL
VEVIDSSRQLYDDACTLLRDRGHSLILREDLETKLSAALANMEMELKKCSVQKCIDGKLR
AYFNVLAPNEESDGRRKSRPFWVRLRSGSTAGQQAFKPPLTNTREAANNWSVNEVVTWLE
TMQLSEYVDSFLKNDIRGKELLTLGRRDLKDLGVVKVGHVKRILQAIKDLSEN
Download sequence
Identical sequences E2QD61
FBpp0291246 NP_731190.3.81976 FBpp0291246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]