SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291294 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291294
Domain Number 1 Region: 357-681
Classification Level Classification E-value
Superfamily L domain-like 6.05e-56
Family Internalin LRR domain 0.059
Further Details:      
 
Domain Number 2 Region: 834-932
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-18
Family I set domains 0.0087
Further Details:      
 
Domain Number 3 Region: 290-381
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000997
Family Internalin LRR domain 0.029
Further Details:      
 
Domain Number 4 Region: 716-823
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000268
Family I set domains 0.032
Further Details:      
 
Domain Number 5 Region: 927-1027
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000172
Family V set domains (antibody variable domain-like) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291294   Gene: FBgn0034083   Transcript: FBtr0302084
Sequence length 1252
Comment pep:known chromosome:BDGP5:2R:12037628:12057024:1 gene:FBgn0034083 transcript:FBtr0302084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSAIKGRHPTRESNDDSSMVISNYRICDIKTSGNGKYLMSWSRRRRRNNNNNNNSSSN
NNNAASESRSNDNCNYSTTNDFNKINKLLLITYMLLITAATICQSAAQSPSSSNGNGVGG
SGSTGGSPLSALLKSGGASYNQQLPQQQLFAMLTRNGGGSSGPRSSGGNRGYTSARQHFM
ALSEDYSDADVDEEDMAALHYPLSASHPPAGVQGSSSSSGISIQSGSLETNGFVADDGGQ
YEHAQKALEAAAAAAKASNKYNIDCPKDCKCLNVLFDCDKLHLERVPVLPSYVQTLHLAN
NKLNDTTVLEIRNLLNLTKVSLKRNLLEVIPKFIGLSGLKHLVLANNHITSISSESLAAL
PLLRTLDLSRNKLHTIELNSFPKSNNLVHLILSFNEITNVNEHSFATLNNLTDLELSNNR
LSTLPIRVFKNLNQLKKLALNFNQLEINWSTFRGLESMKNLQLKSNKIRALQDGVFYVMH
KIETIDLAMNQISSLSRQGLFNLTKLRHLNLSFNAISRIEVDTWEFTQSLEVLDLSNNAI
NEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELNLRRNRLSWIIEDQSAAAP
FKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVNAFEHMLRLNKLVF
KSLNFICDCDLVWFQQWLKNRFPQQAEHAVCGYPEHLLDRHLKSLSSSELVCVDSPKPRV
EQEPDDMLAVNAANITLECIASSPTAASLAAADELKIKWRHDNQHVQERPAVHDGASTET
QIRHDLSTNQTSIYGYLRLTNVTYESAGRYQCVVSNAFGTTYAQKFKISIGIHPTFLQVP
SNLTLDAGEMARLVCSASGDPTPEIALQKFGGSEFPAATERRLQVIREENAFLITNAKPS
DSGIYTCTALSAAGEIKVNATLVVNDKPQPSIPLVHQEVVVGRTCVLQCLSETANADFEL
EHPHREWFKENKPIHISPTAPDGDRYYFSNNKELLVILNAQSNDAGHFRCEITDNSRTFT
LQSELVVVKENLNWVVLLVGIITVTVICVVVDCCIIWCTLRYQKKKLRMSLAAERHSTQL
RPRSLADLGCSYDEANHRRLTVMSTPPSEQRCLEQGLTLSYLRQTDLEAQQDHLSSKDSG
TGSDAAVKRTLDDFEVAMPSHKHHTDDEEEEEVEEVYEENEPPYIKHTYEVNYAEPEQHL
FLQNNNHNYDGGGIGVAGGVNKMVPNALLRKCSAGASGSNYSSIQQCTTVDI
Download sequence
Identical sequences A1ZAB1
FBpp0291294 NP_611091.2.81976 FBpp0291294 FBpp0291294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]