SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291387 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0291387
Domain Number - Region: 109-191
Classification Level Classification E-value
Superfamily Respiratory nitrate reductase 1 gamma chain 0.0157
Family Respiratory nitrate reductase 1 gamma chain 0.044
Further Details:      
 
Domain Number - Region: 71-125
Classification Level Classification E-value
Superfamily RING/U-box 0.0424
Family ZZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291387   Gene: FBgn0039368   Transcript: FBtr0302177
Sequence length 251
Comment pep:known chromosome:BDGP5:3R:21601010:21601928:-1 gene:FBgn0039368 transcript:FBtr0302177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIVNDWCREYANLYPKKAVSIGHPLSVIFLLFFVISAIFTTYNILGNLLACYRTSSAVK
SLPQERQIPKPGTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIGHNNH
RYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFRYVCLILNIFA
LGFPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQRGLWTFISPSLRSPLPH
DGTHWKIKQCF
Download sequence
Identical sequences E1JIY0
FBpp0291387 NP_001163735.1.81976 FBpp0291387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]