SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291388 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291388
Domain Number 1 Region: 62-225,286-431
Classification Level Classification E-value
Superfamily L domain-like 4.52e-41
Family Ngr ectodomain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291388   Gene: FBgn0037553   Transcript: FBtr0302178
Sequence length 555
Comment pep:known chromosome:BDGP5:3R:4045863:4047889:1 gene:FBgn0037553 transcript:FBtr0302178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFYKYILLGICGLTVSDALAVYDASGRFNLSASCPDSFCSLSDRPVAYSATPALQLREL
HLRNCSRQSITWLVLQLTPGLRTLVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRD
QIFNAVPRLEILQLSQNFIHTVHVAAFQGLSKLRLLGLQGNAIAEILSSTLDPLMELVHL
DLSRNELTTLPQNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLDLGHAAELEVMT
LNLTNVQNLVLEGSSLSSLVINGGFIKLQAGNNELNHLQVGNKSSVIEMDLHGNLLNGND
TAALLRGMWNLQRLDLSKNRIEALPQHGSGLDASGTQELLILPSLKFLNLANNQLVRLPP
ESPILSSRLSYLDLSHNLMLTLDVAILRSLSVLKGLYVEGNRLNTINYQKLHEEHPDLSE
LGLHDNPWSSGLYRKMFLYFTDRGVHLQARPQNRVLNKSSRVDIDWPPNEGQAEAQKMDP
PGVTGIHPYWTLRDILAFVTLLVVMIILLMNLYHILEEEGCLRRFRHWRRSRTLGQNTST
TRNSGRRLDEQDSEV
Download sequence
Identical sequences Q9VHV2
FBpp0291388 FBpp0291388 7227.FBpp0081292 NP_649771.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]