SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291419 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291419
Domain Number 1 Region: 351-444
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-18
Family I set domains 0.0078
Further Details:      
 
Domain Number 2 Region: 167-251
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000172
Family V set domains (antibody variable domain-like) 0.072
Further Details:      
 
Domain Number 3 Region: 765-886
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000235
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 284-360
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000144
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  FBpp0291419
Domain Number - Region: 73-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00178
Family I set domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291419   Gene: FBgn0039431   Transcript: FBtr0302209
Sequence length 1298
Comment pep:known chromosome:BDGP5:3R:22296825:22360939:-1 gene:FBgn0039431 transcript:FBtr0302209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLFYNRRLFVIQLIEILLLLLTDHNGRLTLTKESTTVAAAVAQPKNSTALQPYLQIQKH
AVTRLTISKPHSPYYLPCIPILTPYNHDQDNQPIYCSWYRNDVVVEQVSYRKNDFFIYDN
GTLRLPTNEKASGEYYCKIEWDESAVISDRITVEYPVLKRLFPGQQQAANISALENKPLV
LSCPFLSVPAARFSWYFGNDSLTNDNSALILTNGTLILRHLRLEQAGKYKCVAQNTFASK
THRQFIWQLQVEPKDATFYPKNEAGITETAVSEAQLLPAFQNATVFVPAGGSVLLQCHAV
ADFVPIVWYLQPPNNKMVRLSNNSVAYSITNASIARHEGRYSCITPLETQNFQVIVTTPP
RIVSRLPVEVVYIGLSRTLTCRAEGHPEPSITWYHNGVHLNSSYTRYISGNELHVHSFDS
KEEGIYQCVARNVAGEDSATGELRFNRQLEEVNPLQNIRCYPHSFHSINITFDSRTLTSM
FVVYIVRNNPHSWTSFSPMKLNQTSYVVISTDLPVYEPFALITRVLFPTTEVRTGTLVPQ
QMILSSLRSTPVTCCTQGLMLRPIAVGNDTFVKWSQGQLENKKYFILQFSINHTHPHPAQ
LLNGSLQGTLTSVEEKADQVRHHLTEIQPLNQSAAATVLRNVEHEDNVVDDTLELEDDIF
SLVVDASVTGILLQRFTRIKMRVLIITTENEFLGQDFRYVQWKIIENGTSEQSNMPFRLV
TRESRALAFKFLDSLNETCVLECHTEIQAQMSLPSQDPKCQDRNIANSLLLVTGLKPDTR
YNLHFYNCKTRIFYGDIDEKTEQDPPGTISNSKLIKQNGLKLMWEPPINPNGRVHHYDIR
WSLDNVTHEAIVKECTKCSYKFPNVSETAKIHVAVRVMGDTGAGAPMYFDMINNNHTWLK
EESESSHSEVYSGIAIGSLLSIACVFLFGLFIIFQQRNFKARAQGPTHLTTPTDINFGNL
SSASGMPGDSAGGLSGGTLQQDCHEMQTLIPRSRYHIELLPEHSLEYQTSTAAVAVVHLA
NGNGSVQVARRSDQDGAAQGDLGIAGVHNLSQLPLCGVGGTSPERKTVQDAMLQEAKAFY
IPYRHTPPNAVALSSSKQCAVPSGSELEVIVPPNSLPLVTTMPGLGVVGGGGSGGGGVGG
SSRRSGSLSSSSASSSSNGSSKKQFHTNFVRHSNSNDGIYLLAEEEAAATLTPTSEREYA
AVCLTNGFKLPADVAKSGGGTYNTTNNNNSSTNTSQKSATAKERQPRGNGNPISFSHNAC
KVPANGPASVNVNHSSAVKQSWPAATVVHRRAQVDPNG
Download sequence
Identical sequences Q9VBE5
NP_001163744.1.81976 NP_001247317.1.81976 NP_001287544.1.81976 NP_651482.3.81976 FBpp0291419 FBpp0291420 FBpp0291419 FBpp0291419 FBpp0291420 FBpp0293586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]