SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291490 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291490
Domain Number 1 Region: 139-477
Classification Level Classification E-value
Superfamily L domain-like 3.91e-51
Family Internalin LRR domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291490   Gene: FBgn0034540   Transcript: FBtr0302284
Sequence length 808
Comment pep:known chromosome:BDGP5:2R:16533866:16548575:1 gene:FBgn0034540 transcript:FBtr0302284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKLSAILMLLLLCTLAAANDLKDLLEDSTTSSSTSTTSSTIPSSVTSPTTPTAYVVSA
AAVPALVAGRGKSKSTSGKYVNKSSPRKRKAEQVSSLPLPVDDALMEWKCPNITGTRNAE
LECGCDLPHTLRCNIDLHGMMLLADRLRTSPYSISLLDCSLRNVTFLSDAKIFDNVSLHG
LVISSGEIKRVHKSAFLGIRGPLQALGLPGNALMSVPWNALSTLSALERLDLANNKIKAL
GTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCLS
LRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQI
DVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLP
SLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCDCSIRPFAEWLQESQLHSSLSA
SCVTPPRLEGAPLLQVPVETLSCDMDNVEKDNANIMQHLETLAKPNQTSPIKDLSEEIIL
HELHFSTDYGLILTWLLNLSKKDYMCDAIFVYKEEHINEILIDNSPIHCESKVVNGQNTV
SVIVPDSSSLEIGESYRFCLVMIQEQKPDSELNIGCSNITRLERSSPGAVPVSRQYQRRP
YYNANELKPEVVHDAGEDYQVNQRRFNSVVGSQPQQTQQSTLLHSYTVIDSLNKSFLPGL
GLGVLVTSVLVLIWGATRIRQTGGSSGGGGRNGDSIDSNSSSMHNNNNNSRPGTPTATTC
YAASDHIARLADAENGTRYLKLQATTSL
Download sequence
Identical sequences A1ZBX8
FBpp0291490 NP_611506.2.81976 FBpp0291490 FBpp0291490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]