SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291509 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291509
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily L domain-like 7.14e-27
Family Internalin LRR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291509   Gene: FBgn0035497   Transcript: FBtr0302303
Sequence length 362
Comment pep:known chromosome:BDGP5:3L:4094504:4103256:-1 gene:FBgn0035497 transcript:FBtr0302303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFE
DCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEENPCCERAGPNYRSIVLRALPNLK
KLDNVEVTQQEVEDALRGGGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSYPQHSP
PPQQQYQQQQQQQQQQQRGCTTPTKEEYYQSDRPAYPAHYRHSQTDLTEWEEHQQVPQVH
HNPYGSQKQLHQPQRRSAGPEMTPYRNGSARENGGEWDPEDRSRARRPEGRYSDGTSSLS
ASVMNHYSGYHRRPINRLNRIPLSQNSNILSAALCLVKELDYASLEVLEHAVRCRIDELA
NE
Download sequence
Identical sequences E1JIC5
NP_001163343.1.81976 FBpp0291509 FBpp0291509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]