SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291510 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291510
Domain Number 1 Region: 65-165
Classification Level Classification E-value
Superfamily L domain-like 3.26e-25
Family Internalin LRR domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291510   Gene: FBgn0035497   Transcript: FBtr0302304
Sequence length 389
Comment pep:known chromosome:BDGP5:3L:4094343:4101214:-1 gene:FBgn0035497 transcript:FBtr0302304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRSGVWGLGDLPTLLLTSVAPAAFTRPNSRGNLLTSLEVSTLERVTISWTGKTRAPRE
KRGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFEDCTKLQELYLRKNSISDINEIAYLQ
NLPSLRNLWLEENPCCERAGPNYRSIVLRALPNLKKLDNVEVTQQEVEDALRGGGVAAPE
DEVYEDAYQQQQQSRRSSPQQILQQQQHSYPQHSPPPQQQYQQQQQQQQQQQRGCTTPTK
EEYYQSDRPAYPAHYRHSQTDLTEWEEHQQVPQVHHNPYGSQKQLHQPQRRSAGPEMTPY
RNGSARENGGEWDPEDRSRARRPEGRYSDGTSSLSASVMNHYSGYHRRPINRNSNILSAA
LCLVKELDYASLEVLEHAVRCRIDELANE
Download sequence
Identical sequences Q95U18
NP_647857.3.81976 FBpp0291510 FBpp0291510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]