SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291525 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291525
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000612
Family PDZ domain 0.021
Further Details:      
 
Domain Number 2 Region: 113-171
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000631
Family RING finger domain, C3HC4 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291525   Gene: FBgn0085404   Transcript: FBtr0302319
Sequence length 568
Comment pep:known chromosome:BDGP5:3R:18825861:18836284:-1 gene:FBgn0085404 transcript:FBtr0302319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLCTIYACANGTLGLNLSRAPWDPYPWVSGVQAKSSAERGGVRLGDTLLELNGADVLG
LKISELANRLQDHWQSGAEVVTLMMWRQQANIDPNEDPAEASHAVQHGINQQSLQKFATC
LQHISQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVKCPVCRVPLGPRGRCLLSDKL
FTLLAESFPCDGGKTNKVAASQGHGKLSSVNKCTNEYHNQPKMALAKTSSGKSKCGKQIS
RQLETVLVDQSPREIRRKSQQGQEQEQAVQEAVLPRCTLIKVQHQEAAVEHFSEEGHNNM
LVKPKLKLSKKSWRITGPDQDGLRCDEVATINNGVQVQEQQQQQERQQLGHEKSASSESE
YQNYHCPTGKSCSSHSYQLGQPVANKLSTVAMQALAVVENSGGASLSAGSHKQAPAAGVN
QELPLEAGSIGRREWQLLRHLSGDHRLAVLQIYGTFGERLHVRPQLPLEGVACLRLSEES
STFGHVRVHTFFLAVIAIGGGDEHAVFLWHLDHLPHGPTFETVIETPGHRFLGPAHSLRC
SWPEIRASGQFLTLRNLAAKCEVTIKSR
Download sequence
Identical sequences C6SUV4
FBpp0291525 FBpp0291525 NP_001163693.1.81976 NP_001262855.1.81976 FBpp0111519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]