SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291562 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291562
Domain Number 1 Region: 20-65,108-115,162-185
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000831
Family I set domains 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291562   Gene: FBgn0038087   Transcript: FBtr0302367
Sequence length 300
Comment pep:known chromosome:BDGP5:3R:8667569:8674141:-1 gene:FBgn0038087 transcript:FBtr0302367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYGWLMFLFIALLIDYPIAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYK
DHEEFFRYSPLTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGD
APHFKLADKADNMTVAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGE
QPLLGELYPTTDTSLAAHDYVLRRQRLQVQFFLQGQRFFQAGKILELKCVAEIENYPELR
REKTLSASLSQYDNFNNQMPLRHANANSGSAQRSILCGRTSLISAFLAAILLIHCLRRPS
Download sequence
Identical sequences Q9VG24
FBpp0082156 FBpp0291562 FBpp0082156 FBpp0291562 FBpp0082156 NP_001189214.1.81976 NP_001262510.1.81976 NP_650233.3.81976 7227.FBpp0082156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]