SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291638 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291638
Domain Number 1 Region: 34-88
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000574
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291638   Gene: FBgn0033828   Transcript: FBtr0302450
Sequence length 124
Comment pep:known chromosome:BDGP5:2R:9241231:9241973:-1 gene:FBgn0033828 transcript:FBtr0302450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQQGLDATNFGLRSDYSSENGDHPSLFDTIKDGDQPDMCAFCLDRIQNPEKLHCNHAFC
KSCLALYREARNWVAKRCPICRSSLDMDGQVSRQFHDNWRLFGIMMVPLMVLSLGPFYLL
LLYW
Download sequence
Identical sequences Q4QPY0
NP_001188918.1.81976 NP_610866.1.81976 FBpp0086838 FBpp0086838 FBpp0291638 7227.FBpp0086838 FBpp0086838 FBpp0291638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]