SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291689 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291689
Domain Number 1 Region: 107-353
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.53e-42
Family DNA/RNA non-specific endonuclease 0.004
Further Details:      
 
Weak hits

Sequence:  FBpp0291689
Domain Number - Region: 41-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0916
Family Complement control module/SCR domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291689   Gene: FBgn0053346   Transcript: FBtr0302527
Sequence length 364
Comment pep:known chromosome:BDGP5:3R:24494955:24496174:1 gene:FBgn0053346 transcript:FBtr0302527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMHELRYLIITLSLFLTVGNVKSFCQITQAETWTDRLFVHIVNNRYELLLTDQLQPNQQ
ISLLCDGNAQVFTSTCRNNGQFSPPLPRTNCSKAIPPSVVPTSSNICPHTMYLVGFKYGN
TFMELYRSCYDARTMKAYFSINTVYPTNLKSDRPPTVFDKDGIITPADEATFQMNSIYNR
FEYLFGSGQTYVPSSRSLSFDRGHLTPVADYSFPKILRQTNKYLNVVPQYYNINRSNWKI
VENWVRGQKDVLNVCTGALGVLDLLNRSQKSVSIYLAPNKNPVPRWTYKIIRSLTTGIKY
VILTSNNGWETQQPNPASVCKVTACPRTLNPTGTGYTFCCDPIDFIRRNVPNLAGVCWDN
TENV
Download sequence
Identical sequences Q7KRX0
NP_996301.2.81976 FBpp0291689 FBpp0291689 FBpp0291689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]