SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291800 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291800
Domain Number 1 Region: 812-1137
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.37e-53
Family Diacylglycerol kinase-like 0.0054
Further Details:      
 
Domain Number 2 Region: 1322-1445
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.86e-27
Family Ankyrin repeat 0.00049
Further Details:      
 
Weak hits

Sequence:  FBpp0291800
Domain Number - Region: 582-634
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0023
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291800   Gene: FBgn0261549   Transcript: FBtr0302660
Sequence length 1457
Comment pep:known chromosome:BDGP5:X:8819217:8918969:1 gene:FBgn0261549 transcript:FBtr0302660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQQQQPSIDQLPEPTASTSNSATTKPTIATATTSTTTTSGNNFHQQLQATTAATMQRLR
TTFTRSRTPTGAEMKMQNSLEVPKQVRSASFDEMQLESQRASSSLLKQQSSSSASADERS
SEAGFLQVPLAAHQQRSHSFDSATASAGSDDSGTFLEVPRRLKARRSSSTKTPPPCIHCH
YLEEYERRMTAEQRYFIDHRELTALSYSNTSSEASEDEDEVEGHNAEEEEEGSAAIEDAE
EETTEAATEEADEDPRTEVESEHDHDPDDDAALEMDIRIGNMSQGSSIEESRARLPRQMR
RHTIGSSSVTSASEDEGLEGSDNGSPHFGNTLLPPQPTTPCGITFTLSPTNGDYPSPPHL
PLDPGSPPISPCSSNSGRLPALAPIISTPCSSADADDAGAAMGLPVRARRRSISRQEAIF
VEPTGNSLENVSHEEVDNSNTKSSVDTADSLDEASTMATCGSPGAAGGSGASSSHHNAFV
VRDIYLMVPDLKRDRAASVDSCFSKLSSNAKTEELQPSADGCFLTVPNINATRSRSVDIV
LPTDEQARYKALSMTGSTVTYADGRTASASNSRRPIRIVPDWTENAVQGEHYWKPTSASG
DLCCLNEECIKSGQRMKCSACQLVAHHNCIPFVNEKSTLACKPTYRDVGIRQYREQTTTH
HHWVHRKLEKGKCKQCGKFFPMKQAVQSKLFGSKEIVALACAWCHEIYHNKEACFNQAKI
GEECRLGNYAPIIVPPSWIVKLPTKGNFKSSIRVSNKNNAASGSGGGGAGGGAGGGGGKS
KKQTQRRQKGKEEKKEPRAFIVKPIPSPEVIPVIVFINPKSGGNQGHKLLGKFQHLLNPR
QVFDLTQGGPKMGLDMFRKAPNLRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLG
TGNDLARALGWGGGYTDEPIGKILREIGMSQCVLMDRWRVKVTPNDDVTDDHVDRSKPNV
PLNVINNYFSFGVDAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQ
WVTLECDGQDFTGKLRDAGCHAVLFLNIPSYGGGTHPWNDSFGASKPSIDDGLMEVVGLT
TYQLPMLQAGMHGTCICQCRKARIITKRTIPMQVDGEACRVKPSVIEIELLNKALMLSKR
KHGRGDVQVNPLEKMQLHILRVTMQQYEQYHYDKEMLRKLANKLGQIEIESQCDLEHVRN
MLNTKFEESISYPKVSQDWCFIDSCTAEHYFRIDRAQEHLHYICDIAIDELYILDHEAAT
MPQTPDQERSFAAFSQRQAQNERRQMDQAQGRGPGSTDEDLQIGSKPIKVMKWKSPILEQ
TSDAILLAAQSGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRR
LINMADKELGQTALHIAAEQNRRDICVMLVAAGAHLDTLDSGGNTPMMVAFNKNANEIAT
YLESKQGTQPVDGWLDD
Download sequence
Identical sequences Q09103
7227.FBpp0111462 NP_511092.2.81976 FBpp0291800 FBpp0291800 FBpp0291800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]