SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291801 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291801
Domain Number 1 Region: 364-689
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.01e-53
Family Diacylglycerol kinase-like 0.0054
Further Details:      
 
Domain Number 2 Region: 888-1017
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-27
Family Ankyrin repeat 0.00049
Further Details:      
 
Weak hits

Sequence:  FBpp0291801
Domain Number - Region: 134-186
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00129
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291801   Gene: FBgn0261549   Transcript: FBtr0302661
Sequence length 1027
Comment pep:known chromosome:BDGP5:X:8806401:8919841:1 gene:FBgn0261549 transcript:FBtr0302661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPERSISQRDLDEIEIESDEEEEELEQGVGLSTRSRRNRRGASDSPAASRARNATNGIQN
RGRERERERERERSRERFGGTNAADEARFYDDEEQRMEDDGEEDSDEDIEMLDYDTRTAS
ASNSRRPIRIVPDWTENAVQGEHYWKPTSASGDLCCLNEECIKSGQRMKCSACQLVAHHN
CIPFVNEKSTLACKPTYRDVGIRQYREQTTTHHHWVHRKLEKGKCKQCGKFFPMKQAVQS
KLFGSKEIVALACAWCHEIYHNKEACFNQAKIGEECRLGNYAPIIVPPSWIVKLPTKGNF
KSSIRVSNKNNAASGSGGGGAGGGAGGGGGKSKKQTQRRQKGKEEKKEPRAFIVKPIPSP
EVIPVIVFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGPKMGLDMFRKAPNLRVLAC
GGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDLARALGWGGGYTDEPIGKILREIG
MSQCVLMDRWRVKVTPNDDVTDDHVDRSKPNVPLNVINNYFSFGVDAHIALEFHEAREAH
PERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDGQDFTGKLRDAGCHAVLFLNI
PSYGGGTHPWNDSFGASKPSIDDGLMEVVGLTTYQLPMLQAGMHGTCICQCRKARIITKR
TIPMQVDGEACRVKPSVIEIELLNKALMLSKRKHGRGDVQVNPLEKMQLHILRVTMQQYE
QYHYDKEMLRKLANKLGQIEIESQCDLEHVRNMLNTKFEESISYPKVSQDWCFIDSCTAE
HYFRIDRAQEHLHYICDIAIDELYILDHEAATMPQTPDQERSFAAFSQRQAQNERRQMDQ
AQGRGPGSTDEDLQIGSKPIKVMKWKSNKDRLFSFNEDVFGCGFSPILEQTSDAILLAAQ
SGDLNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADKELG
QTALHIAAEQNRRDICVMLVAAGAHLDTLDSGGNTPMMVAFNKNANEIATYLESQERFMH
LEKQTRI
Download sequence
Identical sequences FBpp0291801 NP_001096916.1.81976 FBpp0291801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]