SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291802 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291802
Domain Number 1 Region: 379-704
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.01e-53
Family Diacylglycerol kinase-like 0.0054
Further Details:      
 
Domain Number 2 Region: 889-1012
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-27
Family Ankyrin repeat 0.00049
Further Details:      
 
Weak hits

Sequence:  FBpp0291802
Domain Number - Region: 149-201
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00134
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291802   Gene: FBgn0261549   Transcript: FBtr0302662
Sequence length 1024
Comment pep:known chromosome:BDGP5:X:8907638:8918969:1 gene:FBgn0261549 transcript:FBtr0302662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLLHAVREEFQTEDEYETEVDDEGNVLHRSSISSCSSSSSSSNTSSSSDGSNSTASQP
LSPSLPQPRRRLQRSDSFGSVGGGVAGGVAGSGATGAGGVRRFRRSSIGMQRKSAFRQRK
LDSLGAWRRKRRTASASNSRRPIRIVPDWTENAVQGEHYWKPTSASGDLCCLNEECIKSG
QRMKCSACQLVAHHNCIPFVNEKSTLACKPTYRDVGIRQYREQTTTHHHWVHRKLEKGKC
KQCGKFFPMKQAVQSKLFGSKEIVALACAWCHEIYHNKEACFNQAKIGEECRLGNYAPII
VPPSWIVKLPTKGNFKSSIRVSNKNNAASGSGGGGAGGGAGGGGGKSKKQTQRRQKGKEE
KKEPRAFIVKPIPSPEVIPVIVFINPKSGGNQGHKLLGKFQHLLNPRQVFDLTQGGPKMG
LDMFRKAPNLRVLACGGDGTVGWVLSVLDQIQPPLQPAPAVGVLPLGTGNDLARALGWGG
GYTDEPIGKILREIGMSQCVLMDRWRVKVTPNDDVTDDHVDRSKPNVPLNVINNYFSFGV
DAHIALEFHEAREAHPERFNSRLRNKMYYGQMGGKDLILRQYRNLSQWVTLECDGQDFTG
KLRDAGCHAVLFLNIPSYGGGTHPWNDSFGASKPSIDDGLMEVVGLTTYQLPMLQAGMHG
TCICQCRKARIITKRTIPMQVDGEACRVKPSVIEIELLNKALMLSKRKHGRGDVQVNPLE
KMQLHILRVTMQQYEQYHYDKEMLRKLANKLGQIEIESQCDLEHVRNMLNTKFEESISYP
KVSQDWCFIDSCTAEHYFRIDRAQEHLHYICDIAIDELYILDHEAATMPQTPDQERSFAA
FSQRQAQNERRQMDQAQGRGPGSTDEDLQIGSKPIKVMKWKSPILEQTSDAILLAAQSGD
LNMLRALHEQGYSLQSVNKNGQTALHFACKYNHRDIVKYIIASATRRLINMADKELGQTA
LHIAAEQNRRDICVMLVAAGAHLDTLDSGGNTPMMVAFNKNANEIATYLESKQGTQPVDG
WLDD
Download sequence
Identical sequences FBpp0291802 FBpp0291802 NP_001096917.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]