SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291833 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291833
Domain Number 1 Region: 156-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 55-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00073
Further Details:      
 
Domain Number 3 Region: 487-560
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291833   Gene: FBgn0261552   Transcript: FBtr0302693
Sequence length 572
Comment pep:known chromosome:BDGP5:3R:5243664:5274371:1 gene:FBgn0261552 transcript:FBtr0302693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDATMETCPSPETGDSRKRPLDSDPENEQTKRSHFSSGESVCSGIEVEIENNNNNHIH
HGETTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG
STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGAF
IKQIKEESGSYVQISQKPTDVSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTCLNV
SYADVSGPVANFNPTGSPYATNQNAINSSTASLNSTLGTTIGGANSAASLLVNGTGINLS
INLGSPNPAPNLAVATQLLEHIKVAMRGSGYSETVTNEVVAALSVLAKYGVLGMGVGVSH
TNGAHSTLGNFLGVTTLDQQTAAAASAATASNVFGAVGQVNLEQYAAAVASAAAASRPTQ
SQLDAAAVQFDPFRHLGSATAPAATPVSLNNNSFGLTATTGTATTAQLGGLSKSPTPGDL
SSKDSKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQISKKGIFAPGTRNRIVTITGQP
SAIAKAQYLIEQKINEEETKRARQIPLTTVVN
Download sequence
Identical sequences Q9GQN4
FBpp0110326 FBpp0110327 FBpp0110328 FBpp0291832 FBpp0291833 NP_001036692.1.81976 NP_001189199.1.81976 NP_001189203.1.81976 NP_731351.3.81976 NP_731352.3.81976 FBpp0110326 FBpp0110327 FBpp0110328 FBpp0291832 FBpp0291833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]