SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291844 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291844
Domain Number 1 Region: 49-431
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-92
Family Ankyrin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1190-1264
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000228
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291844   Gene: FBgn0261554   Transcript: FBtr0302704
Sequence length 1498
Comment pep:known chromosome:BDGP5:2R:17186747:17196939:1 gene:FBgn0261554 transcript:FBtr0302704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSRLKTNPGGSENINRFGDSMGSLGHRALLQYIDNNDISGLRAILDSRHLTIDDRDEN
ATTVLMVVAGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEV
EHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLV
QRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTD
CVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAV
KAGHRTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDT
PLLRAVRNRNLEIVHLLLDRKAKVTASDKRGDTCLHIAMRARSKTIVEALLRNPKHSQLL
YRANKAGETPYNIDSLHQKTILGQVFGARRLNTNEDSEGMLGYELYSSALADVLSEPTLT
TPITVGLYAKWGSGKSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVG
LSTWSAVVGVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVA
FCHPPGPQSDSQAKPVRFHFAEANSASPTGDGAVAHMLAALLDAIESHYGWLATRLYRAF
RPKCLKVDVGWRWRRMCCIPIVLIFELALVTVVTGISLTVAYFTFADEKEKEHILVALYV
IAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRSSESAPLTMLGAEVAVMTDMVKCL
DAFTNQQSRLVGVIDALDSCDTERILTLLNAVQTLLSSPNRPFVLLISVDPHVIAKAAEA
NSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPT
LGHSVSARRLSNASEIISSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVL
DLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRA
SMIVLHHDQFMDSNADESVSLQSVYEKLRPKLAYLREAAPLLELDRDERKLDAFLQLHKS
DLLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYV
PSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEG
VISLLDRIEDMKPALPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITT
LRECERLPRKQQRQQQQPGALEAPSNVPMIKDVTDALMQPPRESLSRKNSVSHMEKQVTL
EEQMICGTLQTLNEEAYEDVASSERPSPTGEMLAAVAQLQLAPIRESSEFGSPSDDQKQY
GVKISNNNNNNQYLHAEYNRSVSSHSLQSLSTLVGAPVGHGGSGGSHLHLGNGNDLSDST
LDLMHVDSVFGGGGGGGYHRASRQISISSELLHESSSLPMVVVIPNASGEQAYDDTKL
Download sequence
Identical sequences B7YZM6
FBpp0291844 NP_001137726.1.81976 FBpp0291844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]