SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291848 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291848
Domain Number 1 Region: 199-581
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.65e-92
Family Ankyrin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1340-1414
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000257
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291848   Gene: FBgn0261554   Transcript: FBtr0302708
Sequence length 1648
Comment pep:known chromosome:BDGP5:2R:17187409:17196939:1 gene:FBgn0261554 transcript:FBtr0302708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKDGHSRKPQKRASIAEETPVSDSTTPATTASPSSPSRTAGHSTIGALVSNLHHHDIQS
LHQPLLESEERVIVAVNHRNPRQPHRSYGTERKPHSSLPRFVINIEEETDAAVAAAEGKS
SPAPNQEHEEHSNQSPSRRFSHFNLALRRFSHIHAHVNADYPGYNINRFGDSMGSLGHRA
LLQYIDNNDISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAE
DLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKG
ADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVD
TLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREG
FQDIAASLIAAGAYINIQDRGADTPLIHAVKAGHRTVVEALLKKHADVDIQGKDRKTAIY
TAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLLLDRKAKVTASDKR
GDTCLHIAMRARSKTIVEALLRNPKHSQLLYRANKAGETPYNIDSLHQKTILGQVFGARR
LNTNEDSEGMLGYELYSSALADVLSEPTLTTPITVGLYAKWGSGKSFLLNKLRDEMNNFA
RQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLAYLLLAAVRYC
NYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSASPTG
DGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIPIVLIFELALV
TVVTGISLTVAYFTFADEKEKEHILVALYVIAAVMGTLICTHLHVLAKVFVSLFTSHIRV
LKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAFTNQQSRLVGVIDALDSCDTERILTLLN
AVQTLLSSPNRPFVLLISVDPHVIAKAAEANSRRLFTEGGIGGHDFLRNLVHLPVYLQNS
GLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEIISSQEKLRGPARGG
GGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLTDDYFSDVNPRSMRRLMNVIYIT
VRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIVLHHDQFMDSNADESVSLQSVYEKLRP
KLAYLREAAPLLELDRDERKLDAFLQLHKSDLLVADLRIFLPFTINLDPYLRKVLKEDQQ
TIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELRSRNLSTST
EPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRIEDMKPALPKLAPVLRENAINGR
VLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERLPRKQQRQQQQPGALEAPSNVPMI
KDVTDALMQPPRESLSRKNSVSHMEKQVTLEEQMICGTLQTLNEEAYEDVASSERPSPTG
EMLAAVAQLQLAPIRESSEFGSPSDDQKQYGVKISNNNNNNQYLHAEYNRSVSSHSLQSL
STLVGAPVGHGGSGGSHLHLGNGNDLSDSTLDLMHVDSVFGGGGGGGYHRASRQISISSE
LLHESSSLPMVVVIPNASGEQAYDDTKL
Download sequence
Identical sequences FBpp0291848 FBpp0291848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]