SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292036 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292036
Domain Number 1 Region: 105-378
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.77e-46
Family FCH domain 0.0055
Further Details:      
 
Domain Number 2 Region: 710-767
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-20
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292036   Gene: FBgn0259734   Transcript: FBtr0302905
Sequence length 768
Comment pep:known chromosome:BDGP5:X:8924238:8947352:1 gene:FBgn0259734 transcript:FBtr0302905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFRDNSWLANARSYGVLKSLRSSARYAKAKSKSAINLNAHLKKQQKLEEGHPEKKRQD
KKILRQSVSEDQPIYANVDEVIPIHLEPETGTEVDALMGNAQGQNGFEELRRYVKQGGDF
SKELIFVLQERADSELIYSKSLSKLANKLNKAGREIPGSVADAWRGVATEMESRSDIHRQ
LAASLTDELVKPLKIVVEGHHKARKAVESNVDKAARVLGEWRASEAKAKKASHTAARENE
KLQDAMLDVRIQKSPSIALLHQGPNKQAAEKELKSAEKDCVKLDNKRKKAEEAVKRADVE
YYTLCVRSERARVDWEMAVLRGSAQLQSSEQQRLGNMHNFAQQYARLISDMNPILGGLST
RLQPQLDACNVAKDMQVVRHIRRNSEGPSEQLLPDFYCEHTTLAMNRERRKHALIKLLQL
VKTDLERERRSRDGLRGLSQSLNHQEHQNITDKLYHIRSMLTYLEGARLKLHSALLELDH
KPRATHPLAQHIHITRDRTGLQQSILKVPNWLKNNDKSQTQQSTSMLAHDITDITTNHED
ELPDENCSHLHSSSHSNNNSNGSCTDVSSVVKPFNRSKSNIETNFTSQPKIISTTNAAIA
VSVKSKTLANLQDGHHNNQQHHHHHHNHHSDRGQADGGSNQQDSDFDEFSSQDEDDEPQQ
PQQQPQPLQSQQQQQQPLLQNPTINGQVQTQHFYQNAQELQKGQKNGSVPILGRCKALYS
YTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIGIFPATYVEECA
Download sequence
Identical sequences H1UUM2
FBpp0292036 FBpp0292036 NP_001188566.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]