SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292037 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292037
Domain Number 1 Region: 3-285
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-48
Family FCH domain 0.0081
Further Details:      
 
Domain Number 2 Region: 617-674
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-20
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292037   Gene: FBgn0259734   Transcript: FBtr0302906
Sequence length 675
Comment pep:known chromosome:BDGP5:X:8924238:8947352:1 gene:FBgn0259734 transcript:FBtr0302906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFRDNSWGQNGFEELRRYVKQGGDFSKELIFVLQERADSELIYSKSLSKLANKLNKAG
REIPGSVADAWRGVATEMESRSDIHRQLAASLTDELVKPLKIVVEGHHKARKAVESNVDK
AARVLGEWRASEAKAKKASHTAARENEKLQDAMLDVRIQKSPSIALLHQGPNKQAAEKEL
KSAEKDCVKLDNKRKKAEEAVKRADVEYYTLCVRSERARVDWEMAVLRGSAQLQSSEQQR
LGNMHNFAQQYARLISDMNPILGGLSTRLQPQLDACNVAKDMQVVRHIRRNSEGPSEQLL
PDFYCEHTTLAMNRERRKHALIKLLQLVKTDLERERRSRDGLRGLSQSLNHQEHQNITDK
LYHIRSMLTYLEGARLKLHSALLELDHKPRATHPLAQHIHITRDRTGLQQSILKVPNWLK
NNDKSQTQQSTSMLAHDITDITTNHEDELPDENCSHLHSSSHSNNNSNGSCTDVSSVVKP
FNRSKSNIETNFTSQPKIISTTNAAIAVSVKSKTLANLQDGHHNNQQHHHHHHNHHSDRG
QADGGSNQQDSDFDEFSSQDEDDEPQQPQQQPQPLQSQQQQQQPLLQNPTINGQVQTQHF
YQNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALR
NHIGIFPATYVEECA
Download sequence
Identical sequences M9MQH0
FBpp0292037 NP_572515.2.81976 FBpp0292037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]