SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292038 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292038
Domain Number 1 Region: 556-835
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-45
Family FCH domain 0.0055
Further Details:      
 
Domain Number 2 Region: 1167-1224
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-19
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292038   Gene: FBgn0259734   Transcript: FBtr0302907
Sequence length 1225
Comment pep:known chromosome:BDGP5:X:8936677:8948608:1 gene:FBgn0259734 transcript:FBtr0302907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLRVHKFKLGGKDNAAMADLPQSENTTNNNNNIGSNNNQKGGAKGFLGRIKRYSVLGN
KLGRRNLGSMNLNPPNNVVDNSVSPTKLHTGSYNMTGSHSDDHRLEIGAPILISTTTLDT
DRFDVTEARLKQIGGGIAQTSSIVRTLTPRSSDEEEFVDARSSPQQMERDEDLQIADDQV
EKNDRDQYGHQFQLPKKQHREEEMGDLKYLDDLEEPEQFETPKHEVEEKLLTANQDVKRP
ITPITIAIDPPIRRPRIARQQRQSQSVQNLHRSELKVYLHKSNSVALDMNVTAPAKLGLD
LNLPELPELYGASELSLAASDNKENLPAVKPSAERSPIPNGGFMAQQPHFKSLDSFHLNT
RSHSNQSSQQSSRQSLACSSSNGEYDFDLKSVSYQSLNAQNLFVSIDELQELTRQINETE
DFGKEIDLEYCAHRDQLRPSERRITLLKNKNQTLINFNHNKEKLRKGWHGMKHWLGEEGS
KIKEAVRQQTPLKRLAQSRSNLNQSTADASRQSMSPERTQRDVTESCEDVTERTEMESSM
SHRNSEEDLSPHAKRFKDEGQNGFEELRRYVKQGGDFSKELIFVLQERADSELIYSKSLS
KLANKLNKAGREIPGSVADAWRGVATEMESRSDIHRQLAASLTDELVKPLKIVVEGHHKA
RKAVESNVDKAARVLGEWRASEAKAKKASHTAARENEKLQDAMLDVRIQKSPSIALLHQG
PNKQAAEKELKSAEKDCVKLDNKRKKAEEAVKRADVEYYTLCVRSERARVDWEMAVLRGS
AQLQSSEQQRLGNMHNFAQQYARLISDMNPILGGLSTRLQPQLDACNVAKDMQVVRHIRR
NSEGPSEQLLPDFYCEHTTLAMNRERRKHALIKLLQLVKTDLERERRSRDGLRGLSQSLN
HQEHQNITDKLYHIRSMLTYLEGARLKLHSALLELDHKPRATHPLAQHIHITRDRTGLQQ
SILKVPNWLKNNDKSQTQQSTSMLAHDITDITTNHEDELPDENCSHLHSSSHSNNNSNGS
CTDVSSVVKPFNRSKSNIETNFTSQPKIISTTNAAIAVSVKSKTLANLQDGHHNNQQHHH
HHHNHHSDRGQADGGSNQQDSDFDEFSSQDEDDEPQQPQQQPQPLQSQQQQQQPLLQNPT
INGQVQTQHFYQNAQELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVHAKQ
DDGWWLGALRNHIGIFPATYVEECA
Download sequence
Identical sequences B5RJS0
FBpp0289277 FBpp0292038 FBpp0289277 FBpp0292038 NP_001162711.1.81976 NP_001188567.1.81976 FBpp0289277 7227.FBpp0289277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]