SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292106 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292106
Domain Number 1 Region: 94-299
Classification Level Classification E-value
Superfamily L domain-like 4.54e-35
Family Ngr ectodomain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292106   Gene: FBgn0261674   Transcript: FBtr0302981
Sequence length 458
Comment pep:known chromosome:BDGP5:3L:12784318:12789184:1 gene:FBgn0261674 transcript:FBtr0302981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVYYKFGLLLIFLLSVSISHTNAAPAGSEEANPLEDFNYGDDDYSETATGEESPETAEN
RLMPQSSSTSTTTTFRPIFNIPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDM
PKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISSIDKDVFQGSERLKRLRLANN
RLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWTELPEQTFQN
MSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNIEELCSLLTSIDTISFLNY
DISCYEFVLGTPFNGSLIYPTEPPLKGITNPPIVASITSTAKPVTATPAPPRSANRNRGK
MDNSTELVKAGILSSETSTSGVSVEPPAESQTNQVQISQEAINTLLICIMVLAVIGIVIG
LICRQDIGGIKTKCCRTSKPEPKDQVHPTEEIPLNKLA
Download sequence
Identical sequences Q9VU13
NP_001163434.1.81976 NP_648600.1.81976 NP_729833.1.81976 FBpp0292105 FBpp0292106 FBpp0292107 FBpp0292105 FBpp0292106 FBpp0292107 7227.FBpp0075658 FBpp0292105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]