SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292193 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292193
Domain Number 1 Region: 214-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000175
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 99-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000198
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 156-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000403
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 251-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000214
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  FBpp0292193
Domain Number - Region: 3-45
Classification Level Classification E-value
Superfamily RING/U-box 0.00318
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number - Region: 63-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0155
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292193   Gene: FBgn0261679   Transcript: FBtr0303074
Sequence length 441
Comment pep:known chromosome:BDGP5:3R:11173770:11176113:1 gene:FBgn0261679 transcript:FBtr0303074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKCPRCNCDATGQNRLVTDSCGHTKCRLCLVADVSDCLECRVARSVDIQETQETQARTS
ADKRIIVTDKGYHCTVCNKDFRSRTQQYYHLTCGNDLLKKFNCKECGRRFATSSHLKYHL
MSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPICQKVFRRKSSLASHLAIHSD
LGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRE
RQSCSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPGCAFAS
TVEMVTPRSSAQEATTAEERPSQTVRYNSVIQSVGNVEPVMLLQSTPLPSQLPELQMEKG
KAVPEHLPLPDVMPEENVQLYRKIILDLDNEEYSSEPSPDAQEPAMQHHQPRVPGQGSSK
FSEMHWRKNFKYWYQKEENTK
Download sequence
Identical sequences Q8INE2
NP_732017.3.81976 FBpp0292193 FBpp0292193 FBpp0292193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]