SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292227 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292227
Domain Number 1 Region: 843-968,1078-1249
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-69
Family Protein kinases, catalytic subunit 0.000000568
Further Details:      
 
Domain Number 2 Region: 694-780
Classification Level Classification E-value
Superfamily Immunoglobulin 7.78e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 382-470
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000295
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 473-507,594-666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000195
Family I set domains 0.053
Further Details:      
 
Domain Number 5 Region: 270-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000113
Family I set domains 0.034
Further Details:      
 
Weak hits

Sequence:  FBpp0292227
Domain Number - Region: 58-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0321
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292227   Gene: FBgn0032006   Transcript: FBtr0303108
Sequence length 1500
Comment pep:known chromosome:BDGP5:2L:8221127:8239878:-1 gene:FBgn0032006 transcript:FBtr0303108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLPRLILLPLLLILRISWSDAVPLQQFSPDPDDSIENCGGENGAPLMTPCKSAIILDA
QTSTTLKCEDDEPMSWWTSQSQYVHVKSFDNTEDPARPFGTSLHLIEVTADYVAAYYCVK
TSKFSQIAKEEQSDEAMIELVNQGYASSIYVYVNDPDTKLVDSHNVVTARQYTDVVIPCK
PAMPDTEVLLETSNGEMHSSKSVGRYDPQRGFTIEIRSIVDGGDYYCRPNPPFPHNEEEM
TSIEVRFIGNGHIDKDGKPLPKPVIRSSVEHHVFTDTNFTLDCEQSAYVESVYGMEWFTP
SRDENRIFASQSRTDPKTRNSTHQTGRSTLTVLNAQPSDTGLYKCVTTDNSNQNVQRATY
RIKVLKQNESYLNVGEPSGHYNVQEYANRTIQMTANFEGFPTPSFSWFKPDGTEVRQSEN
NFKILSTELSTMLQVLNAQLQDSGTYVLRGSNSFGVVQREYNVSVMDAPALKMSDAYVQV
GSVARLECTVRSYPPAIVTFFFRPCSLEPQWPTCSVLNQNFSFQTRPRPGKLSVERIYEV
SFLPTEPGILTCIAQNIIDGKERRTLTKAHVLLGNISENMTIYGFDKDHKIAKEDNVNFT
CEALAYHFDGNLKWFINGEDLKESDSVHIETSHTKYSYKSTVHITTISDRDRGTYECRAY
HNDKDAVYSSREIDLYVHDPSAPQWTNGGQEGHSKIKRKLSQTLELECASTAVPVAIVRW
FKDDKEVTESKLRHIIEKESKLLITHLYPGDEGVYKCVVENRLDRIERSFTVVISDLPGI
SMAWVWFGVILFLILIGLCVFLAVRYQKEHKRHLALKAAGLANFEEGAVGHINPDLTLDE
QAELLPYNREFEFPRENLKLGKQLGAGAFGVVLKGEAKGIRREEPTTTVAVKMVKATADN
EVVRALVSELKIMVHLGQHLNVVNLLGAVTKNIAKRELMVIVEYCRFGNIQNFLLRNRKC
FINQINPDTDHIDPSIMTQRMSDNYELHRDTNGGGLKYANVGFPIHSYINEPHNNNTQPP
THRRNSDNDPRSGTRAGRTGSGTATYSYDRQMDTCATVMTTVPEDDQIMSNNSVQPAWRS
NYKTDSTEAMTVTTVDLISWAFQVARGMDYLSSKKVLHGDLAARNILLCEDNVVKICDFG
LARSMYRGDNYKKSENGKLPIKWLALESLSDHVFSTYSDVWSYGIVLWEMFSLAKVPYPG
IDPNQELFNKLNDGYRMEKPKFANQELYEIMLECWRKNPESRPLFAELEKRFANMLGEDV
ASHYLDLNNPYMQSNIEYMKKQSTDYLALMGSPDELAPAAPRYVNGHIVPDIRIEELPDD
YMEMSRDSDPDACTAIFSPTRLEGESSDFPDFSSETTFNFPGARQSPTLSNNLNSGSSKP
LRKKNGMPTVDVADQAPEEIPMLHRSSTGSDGSPEQGRRFNQALKQQYVTPTPSPRHHVE
TKLNGEPSENYVNMKPPRKNIPGKTTTGGGGAAAGASTEAFSNPSYQPLSTVNEKEQRRY
Download sequence
Identical sequences M9MRE1
FBpp0292227 NP_001188720.1.81976 FBpp0292227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]