SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292333 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292333
Domain Number 1 Region: 27-191
Classification Level Classification E-value
Superfamily L domain-like 8.79e-37
Family L domain 0.0002
Further Details:      
 
Domain Number 2 Region: 313-460
Classification Level Classification E-value
Superfamily L domain-like 2.33e-35
Family L domain 0.00026
Further Details:      
 
Domain Number 3 Region: 458-574
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000107
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 4 Region: 170-307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000976
Family Growth factor receptor domain 0.00043
Further Details:      
 
Domain Number 5 Region: 698-794
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000198
Family Fibronectin type III 0.0063
Further Details:      
 
Weak hits

Sequence:  FBpp0292333
Domain Number - Region: 575-633,691-730
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00082
Family Fibronectin type III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292333   Gene: FBgn0032752   Transcript: FBtr0303241
Sequence length 946
Comment pep:known chromosome:BDGP5:2L:19065272:19069850:-1 gene:FBgn0032752 transcript:FBtr0303241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCGNMLLGVGLMFLALYVPCAESKKEHECTSIDIRNECKNMHLLDNCTVVTGYVMITLI
TIEQRCNFSEYSYPLLTEITEFMIFTDVRGLVNITEMFPHLTVIRGRRLFLNYALGVTNM
HELEQLVFPKLVAIQRGQVYIGSCPKLCSIGRVNWDLLTLTRGENNIIMVNKNCSTPVCS
GCSSSHCWSNHYCQRSINENVANPKANINACHEECLGGCKNNSSSPADCSVCRGLSDDGV
CVKSCPKDKYVMENYQRCYTKAECVLKHGYVISGSQCVAFCPSGYKTNNRSECVLCSPDE
ACISFCTPEWPGKAFTVYNLADAENLRGCQIFNGSLVITIRNKVNETQLYQSFTSMREVR
GHVKVYRSSQLRSLQFLRNLERVHGDPLENRHYSFILYDNKELSELWTPSRQLEFMEGGM
FMHRNNKLCNRRMREFQNAVTHDRALDSLQTNDQEVQCSPLKLQLYVQKRTHRSVKLSWL
KSQTSQKIELIHRPLLPGKLYHEESELDAPICTRINWKRRLLFPDDLIENGTHYLFDLDD
LQPDTRYVVLLRTFGNDEAHEAYEARSELTYVQTELDIPKPPLLELVKKTDSSLTVQMAS
HDHVSFLLTVFELSDDQDYIEQRNYCHQPSYVWQDMDGPRWMAYEDYDDCCAQKAEQFED
SRFIADMREQYRCTLDDREQCRRLAHTEVSLPQLRLPGNTTEYELKALHRYRLYALQLQA
CNPLGCSSHTTLYGRTNYTMGADLLTQLYACHIPEMDKYIMRFEEPKKPNGLVTNYVIHF
RNNFSQTHVGCVTRMDHQSAGYMYVKQINITFTECAVRVHSLAGDVMTPYMPISLCSDED
RLQAFHSREAKDLSPEITDLPATASHGRGISIFLICFLFGCSVSLVWVLYKRRCWRKLPG
LRRYVPVREQWLRDRQQTEDREILVDGFETVRFQNNNNSQADDYPM
Download sequence
Identical sequences Q9VJ04
FBpp0080716 FBpp0080716 FBpp0080717 FBpp0080718 FBpp0292333 NP_001188841.1.81976 NP_724157.1.81976 NP_724158.1.81976 NP_724159.1.81976 7227.FBpp0080716 FBpp0080716 FBpp0080717 FBpp0080718 FBpp0292333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]