SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292502 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292502
Domain Number 1 Region: 70-201,233-278
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.47e-26
Family AlkB-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292502   Gene: FBgn0032149   Transcript: FBtr0303447
Sequence length 304
Comment pep:known chromosome:BDGP5:2L:9790882:9791958:1 gene:FBgn0032149 transcript:FBtr0303447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQRGWDTNHVQKD
HENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWDISQSGRRKQNFGPKTNFKKR
KLRLGSFAGFPRTTEYVQRRFEDVPLLRGFQTIEQCSLEYEPSKGASIDPHVDDCWIWGE
RVVTVNCLGDSVLTLTPYEVQQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPM
PNLSLIVLYGPARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF
WQIN
Download sequence
Identical sequences Q9VL81
FBpp0079466 FBpp0292502 FBpp0292503 FBpp0079466 FBpp0292502 FBpp0292503 NP_001188762.1.81976 NP_609314.1.81976 7227.FBpp0079466 FBpp0079466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]