SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292600 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292600
Domain Number 1 Region: 202-283
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000803
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0292600
Domain Number - Region: 102-208
Classification Level Classification E-value
Superfamily EF-hand 0.000105
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number - Region: 439-545
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0085
Family DNA repair protein MutS, domain III 0.048
Further Details:      
 
Domain Number - Region: 199-443
Classification Level Classification E-value
Superfamily TPR-like 0.0493
Family HAT/Suf repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292600   Gene: FBgn0045073   Transcript: FBtr0303567
Sequence length 561
Comment pep:known chromosome:BDGP5:X:15828528:15834543:-1 gene:FBgn0045073 transcript:FBtr0303567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKNTIWNYSLIFFCCVLKSISTLDHGPHTVSVDSNRHNTQHQYKQNPNVASQRHSSHES
GQSLHNSQSEHVTHIAASHAGSGGEHSTHLAQNLHRSSYNLLSEAMSQAVSNEFSSMGSG
SADGACAADDFDCYSGSVQDRFGMEAIASLHRQLDDDDNGNIDLSESDDFLREELKYDSG
YEKRQKAFHFNDDMHISVKELWEAWLRSEVHNWTIEQTTDWLAQSVQLPQYVDLFKLHKV
TGAALPRLAVNNLQYVGNVLGIKDPIHKQKISLKAMDVVLFGPPRETGTRWKDYILVTLL
LSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVATEKL
DLERRLKEAPTLSSSNSDLEVQQLKKEIEMLRNELSRAEFELVDNCWSPPPQLQSWLQYT
YELESKNHQKKRTSAEKQLQSAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRSIVEARN
ALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLYGRNGGLQSSMGMSSTKGSR
ARITNSTEDLDDESIQGFGIP
Download sequence
Identical sequences Q7KUZ1
FBpp0292600 FBpp0292600 NP_996470.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]