SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292906 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292906
Domain Number 1 Region: 678-769,822-1025
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 8.24e-42
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.073
Further Details:      
 
Domain Number 2 Region: 284-400
Classification Level Classification E-value
Superfamily TPR-like 1.99e-20
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 3 Region: 110-249
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000455
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292906   Gene: FBgn0260749   Transcript: FBtr0303903
Sequence length 1130
Comment pep:known chromosome:BDGP5:2L:10272627:10278811:-1 gene:FBgn0260749 transcript:FBtr0303903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQLTFEDDCLIRELDSRYYGFLDLSNSKNAELRNLVQQTITNLQNYIANGQVHESKNSS
DNKNAIQKFEPSTQAGEHMENTSSRNNDDTKPFEQDAKEKVSIIEEKHQDEHYVNALCKL
GHLHLLLGEYSEALSAYQKYLRFRENNYWTNHAFIYGIGVAYFKLRCFKWAIKSFQELLY
LSPNFTCANEVHLRLGLMLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQ
NKHKAAKDGYEFLLNEKNISLELKADVYRQLGWMYHCVECLGEKKEREANALNFLQKSIE
ADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDAL
QAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQSSLIRKKQAIRMK
KDTIGLSKGLSQRITFLEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQQTAQ
MLPRQVTKQSPVQGPPPPYPHSQLSQSPIPSKRIKEDGTSQQEVTQNNSQTSAQNLINIS
ESLNQRNFNAMPESNKSSEQSVLDTFDDISNDIYKQNESIKLERLSQDALSNNEDSRHDF
IGGDNADISTTFKIQMDSKQLMVAVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTRD
QLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPDH
SVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLKDESDKGFP
GSQAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTELQKLPAF
ARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGDCEWFAV
PDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAGCVHWVQ
SIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKVSDTKLF
ELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLFIKEQEK
RHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYTQ
Download sequence
Identical sequences M9MRG4
NP_001188773.1.81976 FBpp0292906 FBpp0292906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]