SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293055 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293055
Domain Number 1 Region: 102-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.54e-17
Family Canonical RBD 0.0000462
Further Details:      
 
Domain Number 2 Region: 6-68
Classification Level Classification E-value
Superfamily RING/U-box 1.1e-16
Family RING finger domain, C3HC4 0.0000688
Further Details:      
 
Weak hits

Sequence:  FBpp0293055
Domain Number - Region: 188-217
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00171
Family CCCH zinc finger 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293055   Gene: FBgn0051716   Transcript: FBtr0304112
Sequence length 1059
Comment pep:known chromosome:BDGP5:2L:10396716:10403206:1 gene:FBgn0051716 transcript:FBtr0304112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLSSNDDAVECPLCMEPLEVDDLTFFPCTCGYQICRFCWHRIRTDENKLCPACRKEYP
ENPADFKPLSQEEMIAFKSQKRQRDQQRKQKITENRKHLANVRVVQKNLVFVVGLPPRLA
DADILKKHEYFGKYGKIHKVVINPSTTYAGVQGPSASAYVTYVNNSDALRAIQSVNNIMI
DGRLIKTSLGTTKYCSHFMKNQQCPKGDCMYLHELGDPEASFTKEEMHQGKHLEYEKRLH
DTLIASLGPNATGIVNGNGASKANVAIPSSSSASSSSSGSGTNGSSASGNAQQKEAWPSL
SVSPINGKEAAATATSSSGKSKREKLRNEKRHEKNKAKNKNGSNTNANASNKENYVPETR
SSTSTETFAEATADAPASTKAEPPQASSNRTRADRGKDRTTASAKEQKKSKEAAPAPAAS
KPAERVETSESTIRQKKAEVTESCEDNLPQKRLAGTNVQRSVSSCSENSEGHVSESSLSE
KSLTGDYVEEKCNSVNSESQQESVKFQEELEKSNEAIVEAETILPTAESSEDISPAAVAP
GNGEVEGCLPVVDPVEPPSLADNGSRVTDALSKLNIFDDTPSFFTSPSFQQAPILKNKLD
LEMRQSHLPDLVNDIDGIQKASNTNEWEEAFKNVMMGNTQHMEEQLLQQQHLQQHQNLRH
QLVLQQEEFLRMQELQKRNNFATQINGPANDFLRAYELRAQANAIIQQQLLQQHAGENLF
GGNMSKFFDFHKSQPQSHHQYLNGHPPQINGNGAVPEPQRVAASLESNRLNSPFVENGLI
NSQQQQQQQQQQQKQRMMGMYEFMPPNTQSQQNRFTQNSIVDDDLGFDPFVETQKGLAEL
MENEVVQKQSINNENPLPKLPPQPQVPPHPQLVDNLQRARMPPPGFNHVNTLGLGGASRL
QLTSKIIPFMNMPVNGVGNSGAQGQHQMPMGVNWNAPMGMHQNPGQPVGDSQLQHPMAHN
KVYNNSDWTSMDPAILSFRQYSSFPQNQIPPHPQQQQDLFLQHLAQQQNSQSGGFNNQAQ
QMLPMGMPNSLLNGQQTQPPQVNANVQGMLEFLKSRQFV
Download sequence
Identical sequences M9MRH8
FBpp0293055 FBpp0293055 NP_001188776.1.81976 FBpp0079601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]