SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293057 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293057
Domain Number 1 Region: 536-735
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-44
Family SPRY domain 0.0021
Further Details:      
 
Domain Number 2 Region: 472-565
Classification Level Classification E-value
Superfamily Fibronectin type III 2.98e-18
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 247-309
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000029
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 2-36
Classification Level Classification E-value
Superfamily RING/U-box 0.000000381
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293057   Gene: FBgn0051721   Transcript: FBtr0304114
Sequence length 740
Comment pep:known chromosome:BDGP5:2L:10544881:10627374:1 gene:FBgn0051721 transcript:FBtr0304114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDELRCPTCKQLYANPVLLPCFHALCLGCALDIQTPYSPGSALPGAVNGAGAASAAGHN
GLHGNGGGAGGGAAAPVTNPNGPGTRHSSHSSAASTASSNTGSESVTSDQDQSDKVSIFS
EADSGVVCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLP
TYRAMEAIVDRFCAREALRCQMCETDPKVASLICEQCEIRYCDACRELTHPARGPLAKHT
LVKPRGAAQQRESVCGEHEETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKT
ELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLL
EAIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTN
TDMTWHQEVTNAAPRVSPIVDLTLDDAALARAIDNLNFIQMRAVKDGDERCPAAPMTPTI
LPSDCSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNSM
YNARVKAFNSAGEGEYSELIGLQTAEVAWFTFDPVLSGGAGSGLIFSKNNATVSVEGWEH
RVALGSVGFSRGVHYWEFTIDNYTADTDPAFGVARIDVARNKMLGKDEKSFAMYIDRQRS
WFQHNSIHERRVEGGITTGSTIGVLLDLERHTLSFLVNEMPQGSVAFRDLYGVFYPAVSI
NRGVTLTMHTAMDAPKMDYF
Download sequence
Identical sequences M9MRI4
FBpp0293057 FBpp0293057 NP_001188786.1.81976 FBpp0293057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]